Molecule Information

General Information of the Molecule (ID: Mol02104)

• Name: Solute carrier family 2, facilitated glucose transporter member 1 (Glucose transporter type 1, erythrocyte/brain) (GLUT-1) (GT1) ,Mus musculus
• Synonyms: Solute carrier family 2; facilitated glucose transporter member 1 (Glucose transporter type 1; erythrocyte/brain) (GLUT-1) (GT1); Slc2a1; Glut1
• Molecule Type: Protein
• Gene Name: Glut1
• Gene ID: 20525
• Location: Chromosome 4: 118,965,908-118,995,180 forward strand
• Sequence:
  MDPSSKKVTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWNHRYGEPIPSTT
  LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVAAVLMGFSKLGKSFE
  MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
  GNADLWPLLLSVIFIPALLQCILLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRD
  LQEMKEEGRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
  AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAVLMTIALALLER
  LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
  CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
  ELFHPLGADSQV
• Function: Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake. Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses. Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain. In association with BSG and NXNL1, promotes retinal cone survival by increasing glucose uptake into photoreceptors.
• Uniprot ID: GTR1_MOUSE
• Ensembl ID: ENSMUSG00000028645

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: 9989
Family: Muridae
Genus: Mus
Species: Mus musculus

Type(s) of Resistant Mechanism of This Molecule

  RTDM: Regulation by the Disease Microenvironment

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Iopamidol

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Regulation by the Disease Microenvironment (RTDM)

Disease Class: Multiple myeloma [1]

• Resistant Disease: Multiple myeloma [ICD-11: 2A83.0]
• Resistant Drug: Iopamidol
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: NCI-H508 cells; Colon; Homo sapiens (Human); CVCL_1564
• In Vivo Model: Orthotopic BM engrafted MM xenograft model; Mus musculus
• Experiment for Molecule Alteration: Immunohistochemistry and histologic analysis
• Experiment for Drug Resistance: Micro-Computed Tomography; Positron emission tomography; Magnetic resonance spectroscopy; Magnetic resonance imaging (MRI)
• Mechanism Description: Adaptive responses to hypoxia may be an essential element in MM progression and drug resistance. This metabolic adaptation involves a decrease in extracellular pH (pHe), and it depends on the upregulation of glucose transporters (GLUTs) that is common in hypoxia and in cancer cells.

References

• Ref 1: AcidoCEST MRI Evaluates the Bone Microenvironment in Multiple Myeloma .Mol Imaging Biol. 2021 Dec;23(6):865-873. doi: 10.1007/s11307-021-01611-2. Epub 2021 May 3. 10.1007/s11307-021-01611-2