Molecule Information
General Information of the Molecule (ID: Mol02090)
| Name |
G2-specific protein kinase (NIMA)
,Bacteroides fragilis
|
||||
|---|---|---|---|---|---|
| Synonyms |
NIMA
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
NIMA
|
||||
| Sequence |
MVESLVYLVLHTRLAGRILLCQPKHSGTLLDLIGQNTGFTEDNDTPEIGCKLGRNYPVLL
HHTKRDFGMLPDGIHLMPLHGTVKINLPVGIHIAHGDGIRISVIAMKGKRTAGHALQYRQ AFFGRQQLAFAPHFSEHHISFI Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Metronidazole | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | THP1 cells | Pleural effusion | Homo sapiens (Human) | CVCL_0006 |
| Mechanism Description | In B. fragilis, nimA encodes a 5-nitroimidazole reductase reducing the metronidazole analogue dimetronidazole (1,2-dimethyl-5-nitroimidazole) to the amino derivative, preventing ring fission and associated toxicity. The role of nim genes in metronidazole resistance is controversial. It has been established that overexpression of a NimA homologue from B. fragilis induces a 3-fold increase in metronidazole resistance in E. coli. | |||
| Disease Class: Bacillus clausii infection [ICD-11: 1C4Y.1] | [1] | |||
| Resistant Disease | Bacillus clausii infection [ICD-11: 1C4Y.1] | |||
| Resistant Drug | Metronidazole | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Vero cells | Kidney | Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus) | CVCL_0059 |
| Mechanism Description | In B. fragilis, nimA encodes a 5-nitroimidazole reductase reducing the metronidazole analogue dimetronidazole (1,2-dimethyl-5-nitroimidazole) to the amino derivative, preventing ring fission and associated toxicity. The role of nim genes in metronidazole resistance is controversial. It has been established that overexpression of a NimA homologue from B. fragilis induces a 3-fold increase in metronidazole resistance in E. coli. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
