Molecule Information

General Information of the Molecule (ID: Mol02080)

• Name: HTH-type transcriptional activator (RHAR) ,Bacteroides thetaiotaomicron
• Synonyms: rhaR; GAN91_29155
• Molecule Type: Protein
• Gene Name: RHAR
• Sequence:
  MVFCNNANLLNVFVRHIANNQLRSLAEVATVAHQLKLLKDDFFASDQQAVAVADRYPQDV
  FAEHTHDFCELVIVWRGNGLHVLNDRPYRITRGDLFYIHADDKHSYASVNDLVLQNIIYC
  PERLKLNLDWQRAIPGFSASAGQPHWRLGSMGMAQARQIIGQLEHESSQHVPFANEMAEL
  LFGQLVMLLNRHRYTSDSLPPTSSETLLDKLITRLAASLKSPFALDEFCDEASCSERVLR
  QQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTECGFEDSNYFSVVFTRETGMT
  PSQWRHLNSQKD
• Uniprot ID: A0A6I0SC50_BACT4

Kingdom: N.A.
Phylum: Bacteroidetes
Class: Bacteroidia
Order: 171549
Family: Bacteroidaceae
Genus: Bacteroides
Species: Bacteroides thetaiotaomicron

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Metronidazole

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Bacillus clausii infection [ICD-11: 1C4Y.1] [1]

• Resistant Disease: Bacillus clausii infection [ICD-11: 1C4Y.1]
• Resistant Drug: Metronidazole
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Vero/TMPRSS2 cells; Kidney; Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus); CVCL_YQ48
• Mechanism Description: In B. thetaiotaomicron, the upregulation of rhamnose catabolism regulatory protein (RhaR) results in a similar rerouting and increased resistance to metronidazole.

References

• Ref 1: Metronidazole: an update on metabolism, structure-cytotoxicity and resistance mechanisms .J Antimicrob Chemother. 2018 Feb 1;73(2):265-279. doi: 10.1093/jac/dkx351. 10.1093/jac/dkx351