Molecule Information

General Information of the Molecule (ID: Mol02078)

• Name: D-alanine ligase (vanD5) ,Enterococcus faecium
• Synonyms: vanD; ddl; Tn6712_000090
• Molecule Type: Protein
• Gene Name: vanD5
• Sequence:
  MFKIKVAVLFGGCSEEHNVSIKSAMEIAANIDTKKYQPYYIGITKSGVWKMCEKPCLEWE
  QYAGDPVVFSPDRNTHGLLIQKDTGYEIQPVDVVFPMIHGKFGEDGSIQGLLELSGIPYV
  GCDIQSSVICMDKALAYIVVKNAGIAVPGFRILQEGDRLETEDFVYPVFVKPARSGSSFG
  VNKVCKAEELQAAIEEARKYDSKILIEEAVTGSEVGCAILGNGNNLMAGEVDQIELRHGF
  FKIHQEAQPEKGSENAVIRVPAALPDEVRERIQKTAMKIYRILGCRGLARIDLFLREDGY
  IVLNEVNTMPGFTSYSRYPRMMTAAGFTLSEILDRLIELSLRR
• Function: Cell wall formation.
• Uniprot ID: A0A8F5Z8R9_ENTFC

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: 186826
Family: Enterococcaceae
Genus: Enterococcus
Species: Enterococcus faecium

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Teicoplanin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Enterococcus faecium meningitis [1]

• Resistant Disease: Enterococcus faecium meningitis [ICD-11: 1D01.2]
• Resistant Drug: Teicoplanin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Enterococcus faecium isolates; 1352
• Experiment for Molecule Alteration: Whole-genome sequencing assay
• Experiment for Drug Resistance: Broth dilution assay
• Mechanism Description: Glycopeptide (vancomycin and teicoplanin) resistance is attributed to the acquisition of vancomycin resistance (van) genes. Nine van genes that encode a D-Ala:D-Lac or D-Ala:D-Ser ligase (vanA, vanB, vanC, vanD, vanE, vanG, vanL, vanM and vanN) have been identified in Enterococcus spp. d-Alanyl:d-lactate (d-Ala:d-Lac) and d-alanyl:d-serine ligases are key enzymes in vancomycin resistance of Gram-positive cocci. They catalyze a critical step in the synthesis of modified peptidoglycan precursors that are low binding affinity targets for vancomycin.

References

• Ref 1: Emergence of vancomycin- and teicoplanin-resistant Enterococcus faecium via vanD5-harbouring large genomic island .J Antimicrob Chemother. 2020 Sep 1;75(9):2411-2415. doi: 10.1093/jac/dkaa220. 10.1093/jac/dkaa220