Molecule Information

General Information of the Molecule (ID: Mol02073)

• Name: Cytochrome b (CYB) ,Plasmodium falciparum
• Synonyms: MT-CYB; COB; CYTB; MTCYB
• Molecule Type: Protein
• Gene Name: CYB
• Sequence:
  MNFYSINLVKAHLINYPCPLNINFLWNYGFLLGIIFFIQIITGVFLASRYTPDVSYAYYS
  IQHILRELWSGWCFRYMHATGASLVFLLTYLHILRGLNYSYMYLPLSWISGLILFMIFIV
  TAFVGYVLPWGQMSYWGATVITNLLSSIPVAVIWICGGYTVSDPTIKRFFVLHFILPFIG
  LCIVFIHIFFLHLHGSTNPLGYDTALKIPFYPNLLSLDVKGFNNVIILFLIQSLFGIIPL
  SHPDNAIVVNTYVTPSQIVPEWYFLPFYAMLKTVPSKPAGLVIVLLSLQLLFLLAEQRSL
  TTIIQFKMIFGARDYSVPIIWFMCAFYALLWIGCQLPQDIFILYGRLFIVLFFCSGLFVL
  VHYRRTHYDYSSQANI
• Function: Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. Contributes to the generation of a proton gradient across the mitochondrial membrane that is then used for ATP synthesis.
• Uniprot ID: CYB_PLAFA

Kingdom: N.A.
Phylum: Apicomplexa
Class: Aconoidasida
Order: 5819
Family: Plasmodiidae
Genus: Plasmodium
Species: Plasmodium falciparum

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Atovaquone

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Falciparum malaria [ICD-11: 1F40.0] [1]

• Resistant Disease: Falciparum malaria [ICD-11: 1F40.0]
• Resistant Drug: Atovaquone
• Molecule Alteration: Missense mutation; p.T268C
• Experimental Note: Identified from the Human Clinical Data
• Experiment for Molecule Alteration: Sanger sequencing analysis
• Mechanism Description: Sequencing confirmed Tyr268Cys mutation in the cytochrome b gene, associated with atovaquone resistance, in isolates collected on days 29 and 34 and P. falciparum dihydrofolate reductase mutation Asn51Ile, associated with proguanil resistance in all successfully sequenced samples.

Disease Class: Falciparum malaria [ICD-11: 1F40.0] [1]

• Resistant Disease: Falciparum malaria [ICD-11: 1F40.0]
• Resistant Drug: Atovaquone
• Molecule Alteration: Missense mutation; p.Y268S
• Experimental Note: Identified from the Human Clinical Data
• Experiment for Molecule Alteration: Sanger sequencing analysis
• Mechanism Description: Sequencing confirmed Tyr268Cys mutation in the cytochrome b gene, associated with atovaquone resistance, in isolates collected on days 29 and 34 and P. falciparum dihydrofolate reductase mutation Asn51Ile, associated with proguanil resistance in all successfully sequenced samples.

References

• Ref 1: Atovaquone/Proguanil Resistance in an Imported Malaria Case in Chile .Am J Trop Med Hyg. 2021 Mar 29;104(5):1811-1813. doi: 10.4269/ajtmh.20-1095. 10.4269/ajtmh.20-1095