Molecule Information

General Information of the Molecule (ID: Mol02072)

• Name: Hydroxymethylpterin pyrophosphokinase-dihydropteroate synthetase (DHPS) ,Plasmodium vivax
• Synonyms: DHPS
• Molecule Type: Protein
• Gene Name: DHPS
• Sequence:
  RMIAIDILFFNNYPIFEKSISLKGEDIYKIITKYIHINHTSDQNRLDIIQNLGDKIEFLC
  IPHVYTKYRYSILLCLNDIIPEYKHSTFEEAIRSTYNSYVESFEEKYHINIRKNNKRLYV
  LKDKVSYLKERTHIVGILNVNYDSFSDGGLFVDPVKAVERMFEMASDGASVIDIGGESSG
  PYVVPNPSVTERDLVMPVLKLFKEEWHKLECEVGGGAVCCAAASDARKNAQSSLQGKLQK
  VRDAKPIISIDTVNYDLFKECVEGE
• Uniprot ID: D5K9Y2_PLAVI

Kingdom: N.A.
Phylum: Apicomplexa
Class: Aconoidasida
Order: Haemosporida
Family: Plasmodiidae
Genus: Plasmodium
Species: Plasmodium vivax

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Pyrimethamine/Sulfadoxine

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Plasmodium vivax malaria [1]

• Resistant Disease: Plasmodium vivax malaria [ICD-11: 1F41.0]
• Resistant Drug: Pyrimethamine/Sulfadoxine
• Molecule Alteration: SNP; .
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Red blood cells; Blood; Homo sapiens (Human); N.A.
• Experiment for Molecule Alteration: Whole genome sequencing assay
• Experiment for Drug Resistance: Giemsa stain assay
• Mechanism Description: The lack of copy number variation of pvgch1 suggests that SP-resistant P. vivax may harbor alternative mechanisms to secure sufficient folate.The quadruple mutant haplotypes 57I/L/58R/61M/117T of pvdhfr gene were the most common (comprising 76% of cases in Myitsone and 43.7% of case in Laiza). The double mutant haplotype 383G/553G of pvdhps gene was also prevalent at each site.

References

• Ref 1: Polymorphism of Antifolate Drug Resistance in Plasmodium vivax From Local Residents and Migrant Workers Returned From the China-Myanmar Border .Front Cell Infect Microbiol. 2021 Jun 24;11:683423. doi: 10.3389/fcimb.2021.683423. eCollection 2021. 10.3389/fcimb.2021.683423