Molecule Information
General Information of the Molecule (ID: Mol02068)
Name |
Fusion glycoprotein F0 (F)
,Respiratory syncytial virus
|
||||
---|---|---|---|---|---|
Synonyms |
F
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
F
|
||||
Sequence |
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIE
LSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLN NAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVS LSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVN AGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYV VQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKV QSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT KCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDP LVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLS LIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN Click to Show/Hide
|
||||
Function |
[Fusion glycoprotein F0]: Inactive precursor that is cleaved at two sites by a furin-like protease to give rise to the mature F1 and F2 fusion glycoproteins.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Respiratory trac infection | [1] | |||
Resistant Disease | Respiratory trac infection [ICD-11: CA45.0] | |||
Resistant Drug | Palivizumab | |||
Molecule Alteration | Missense mutation | p.N262D |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Schistosoma haematobium strain | 6185 | ||
Mechanism Description | Clinical isolates N262D, K272E/M/Q, and S275F/L were reported as possessing mutations in the F protein region palivizumab-binding site (amino acids 258-275) and exhibiting resistance to palivizumab neutralization, while laboratory induced isolates N268I, and K272N/T/M/Q have also been reported. | |||
Disease Class: Respiratory trac infection | [1] | |||
Resistant Disease | Respiratory trac infection [ICD-11: CA45.0] | |||
Resistant Drug | Palivizumab | |||
Molecule Alteration | Missense mutation | p.N268I |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Schistosoma haematobium strain | 6185 | ||
Mechanism Description | Clinical isolates N262D, K272E/M/Q, and S275F/L were reported as possessing mutations in the F protein region palivizumab-binding site (amino acids 258-275) and exhibiting resistance to palivizumab neutralization, while laboratory induced isolates N268I, and K272N/T/M/Q have also been reported. | |||
Disease Class: Respiratory trac infection | [1] | |||
Resistant Disease | Respiratory trac infection [ICD-11: CA45.0] | |||
Resistant Drug | Palivizumab | |||
Molecule Alteration | Missense mutation | p.K272E |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Schistosoma haematobium strain | 6185 | ||
Mechanism Description | Clinical isolates N262D, K272E/M/Q, and S275F/L were reported as possessing mutations in the F protein region palivizumab-binding site (amino acids 258-275) and exhibiting resistance to palivizumab neutralization, while laboratory induced isolates N268I, and K272N/T/M/Q have also been reported. | |||
Disease Class: Respiratory trac infection | [1] | |||
Resistant Disease | Respiratory trac infection [ICD-11: CA45.0] | |||
Resistant Drug | Palivizumab | |||
Molecule Alteration | Missense mutation | p.K272M |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Schistosoma haematobium strain | 6185 | ||
Mechanism Description | Clinical isolates N262D, K272E/M/Q, and S275F/L were reported as possessing mutations in the F protein region palivizumab-binding site (amino acids 258-275) and exhibiting resistance to palivizumab neutralization, while laboratory induced isolates N268I, and K272N/T/M/Q have also been reported. | |||
Disease Class: Respiratory trac infection | [1] | |||
Resistant Disease | Respiratory trac infection [ICD-11: CA45.0] | |||
Resistant Drug | Palivizumab | |||
Molecule Alteration | Missense mutation | p.K272Q |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Schistosoma haematobium strain | 6185 | ||
Mechanism Description | Clinical isolates N262D, K272E/M/Q, and S275F/L were reported as possessing mutations in the F protein region palivizumab-binding site (amino acids 258-275) and exhibiting resistance to palivizumab neutralization, while laboratory induced isolates N268I, and K272N/T/M/Q have also been reported. | |||
Disease Class: Respiratory trac infection | [1] | |||
Resistant Disease | Respiratory trac infection [ICD-11: CA45.0] | |||
Resistant Drug | Palivizumab | |||
Molecule Alteration | Missense mutation | p.S275F |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Schistosoma haematobium strain | 6185 | ||
Mechanism Description | Clinical isolates N262D, K272E/M/Q, and S275F/L were reported as possessing mutations in the F protein region palivizumab-binding site (amino acids 258-275) and exhibiting resistance to palivizumab neutralization, while laboratory induced isolates N268I, and K272N/T/M/Q have also been reported. | |||
Disease Class: Respiratory trac infection | [1] | |||
Resistant Disease | Respiratory trac infection [ICD-11: CA45.0] | |||
Resistant Drug | Palivizumab | |||
Molecule Alteration | Missense mutation | p.S275L |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Schistosoma haematobium strain | 6185 | ||
Mechanism Description | Clinical isolates N262D, K272E/M/Q, and S275F/L were reported as possessing mutations in the F protein region palivizumab-binding site (amino acids 258-275) and exhibiting resistance to palivizumab neutralization, while laboratory induced isolates N268I, and K272N/T/M/Q have also been reported. | |||
Disease Class: Respiratory trac infection | [1] | |||
Resistant Disease | Respiratory trac infection [ICD-11: CA45.0] | |||
Resistant Drug | Palivizumab | |||
Molecule Alteration | Missense mutation | p.K272N |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Schistosoma haematobium strain | 6185 | ||
Mechanism Description | Clinical isolates N262D, K272E/M/Q, and S275F/L were reported as possessing mutations in the F protein region palivizumab-binding site (amino acids 258-275) and exhibiting resistance to palivizumab neutralization, while laboratory induced isolates N268I, and K272N/T/M/Q have also been reported. | |||
Disease Class: Respiratory trac infection | [1] | |||
Resistant Disease | Respiratory trac infection [ICD-11: CA45.0] | |||
Resistant Drug | Palivizumab | |||
Molecule Alteration | Missense mutation | p.K272T |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Schistosoma haematobium strain | 6185 | ||
Mechanism Description | Clinical isolates N262D, K272E/M/Q, and S275F/L were reported as possessing mutations in the F protein region palivizumab-binding site (amino acids 258-275) and exhibiting resistance to palivizumab neutralization, while laboratory induced isolates N268I, and K272N/T/M/Q have also been reported. | |||
Disease Class: Respiratory trac infection | [1] | |||
Resistant Disease | Respiratory trac infection [ICD-11: CA45.0] | |||
Resistant Drug | Palivizumab | |||
Molecule Alteration | Missense mutation | p.K272M |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Schistosoma haematobium strain | 6185 | ||
Mechanism Description | Clinical isolates N262D, K272E/M/Q, and S275F/L were reported as possessing mutations in the F protein region palivizumab-binding site (amino acids 258-275) and exhibiting resistance to palivizumab neutralization, while laboratory induced isolates N268I, and K272N/T/M/Q have also been reported. | |||
Disease Class: Respiratory trac infection | [1] | |||
Resistant Disease | Respiratory trac infection [ICD-11: CA45.0] | |||
Resistant Drug | Palivizumab | |||
Molecule Alteration | Missense mutation | p.K272Q |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Schistosoma haematobium strain | 6185 | ||
Mechanism Description | Clinical isolates N262D, K272E/M/Q, and S275F/L were reported as possessing mutations in the F protein region palivizumab-binding site (amino acids 258-275) and exhibiting resistance to palivizumab neutralization, while laboratory induced isolates N268I, and K272N/T/M/Q have also been reported. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.