General Information of the Molecule (ID: Mol02049)
Name
Bifunctional dihydrofolate reductase-thymidylate synthase (PVDHFR) ,Plasmodium vivax
Synonyms
dhfr; dfhr
    Click to Show/Hide
Molecule Type
Protein
Gene Name
Pvdhfr
Sequence
MEDLSDVFDIYAICACCKVAPTSEGTKNEPFSPRTFRGLGNKGTLPWKCNSVDMKYFRSV
TTYVDESKYEKLKWKRERYLRMEASQGGGDNTSGGDNTHGGDNADKLQNVVVMGRSNWES
IPKQYKPLPNRINVVLSKTLTKEDVKEKVFIIDSIDDLLLLLKKLKYYKCFIIGGAQVYR
ECLSRNLIKQIYFTRIN
    Click to Show/Hide
Function
Bifunctional enzyme. Involved in de novo dTMP biosynthesis. Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, DNA precursor synthesis, and for the conversion of dUMP to dTMP.
    Click to Show/Hide
Uniprot ID
Q0PW60_PLAVI
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Apicomplexa
Class: Aconoidasida
Order: Haemosporida
Family: Plasmodiidae
Genus: Plasmodium
Species: Plasmodium vivax
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Pyrimethamine/Sulfadoxine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Plasmodium vivax malaria [1]
Resistant Disease Plasmodium vivax malaria [ICD-11: 1F41.0]
Resistant Drug Pyrimethamine/Sulfadoxine
Molecule Alteration SNP
.
Experimental Note Identified from the Human Clinical Data
In Vitro Model Red blood cells Blood Homo sapiens (Human) N.A.
Experiment for
Molecule Alteration
Whole genome sequencing assay
Experiment for
Drug Resistance
Giemsa stain assay
Mechanism Description The lack of copy number variation of pvgch1 suggests that SP-resistant P. vivax may harbor alternative mechanisms to secure sufficient folate.The quadruple mutant haplotypes 57I/L/58R/61M/117T of pvdhfr gene were the most common (comprising 76% of cases in Myitsone and 43.7% of case in Laiza). The double mutant haplotype 383G/553G of pvdhps gene was also prevalent at each site.
References
Ref 1 Polymorphism of Antifolate Drug Resistance in Plasmodium vivax From Local Residents and Migrant Workers Returned From the China-Myanmar Border .Front Cell Infect Microbiol. 2021 Jun 24;11:683423. doi: 10.3389/fcimb.2021.683423. eCollection 2021. 10.3389/fcimb.2021.683423
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.