Molecule Information
General Information of the Molecule (ID: Mol02044)
| Name |
Multidrug export protein MepA (cdeA)
,Clostridioides difficile
|
||||
|---|---|---|---|---|---|
| Synonyms |
eA; cdeA; BN1096_590031; BN1097_570030; E5F35_13510
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
cdeA
|
||||
| Sequence |
MENLFTRKFTTFEFLKFVSPAIISMIFISLYTIIDGIFVSTLVGSDALASINIVLPIINL
VCGFGIMMATGGGAIVSIRMGENRQDEANSTFSFIVLFSLIVGILFTVISYFFIKEISIL LGATDKLLPYCITYGKVMILCTPFYILKFIFEYFARTDGNSKFSLFLSVIGGVTNIILDY VFIKYFGMGLLGAAVATAIGIILTCVLGIIYFLSNKSTLKLRKPKTDFRLIRDTMINGSS EMVTELSTGITTFLFNVVALKLAGENGLAALTIVLYAHFLMTSVYLGFAAGVSPLISYNF GAENSDKLKETFKHSLKFIFISSLLVFIIALVFAPFIVRVFVNPDNTVFKLALQGLKIFA FAFLFVGINIFASGFFTAFHNGKISAIISFSRAFVFIIIGIIILPPMLNMTGLWLTVPFA EVITIFISILFIKKYKGRYKY Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Clostridium difficile infection | [1] | |||
| Resistant Disease | Clostridium difficile infection [ICD-11: 1A04.0] | |||
| Resistant Drug | Ciprofloxacin XR | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| Mechanism Description | In C. difficile, two secondary active transporters belonging to the MFS and MATE families have been reported to be associated with drug resistance. Heterologous expression of the clostridial Cme protein in the MFS subfamily promotes ERY resistance in Enterococcus faecalis. A sodium-dependent efflux pump of the MATE subfamily encoded by the cdeA gene of C. difficile attributes resistance to norfloxacin and ciprofloxacin when the gene was overexpressed in Escherichia coli. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Clostridium difficile infection | [1] | |||
| Resistant Disease | Clostridium difficile infection [ICD-11: 1A04.0] | |||
| Resistant Drug | Norfloxacin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| Mechanism Description | In C. difficile, two secondary active transporters belonging to the MFS and MATE families have been reported to be associated with drug resistance. Heterologous expression of the clostridial Cme protein in the MFS subfamily promotes ERY resistance in Enterococcus faecalis. A sodium-dependent efflux pump of the MATE subfamily encoded by the cdeA gene of C. difficile attributes resistance to norfloxacin and ciprofloxacin when the gene was overexpressed in Escherichia coli. | |||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
