Molecule Information
General Information of the Molecule (ID: Mol02038)
Name |
23S rRNA (cytidine-2'-O)-methyltransferase TlyA (TLYA)
,Campylobacter jejuni
|
||||
---|---|---|---|---|---|
Synonyms |
tlyA; CJJ81176_0616
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
TLYA
|
||||
Sequence |
MRFDFFVSKRLNISRNKALELIENEEVLLNGKSFKASFDVKNFLENLKKTQDLNPEDILL
TDGLKLDLLSEIYVSRAALKLKNFLEENGIEIKHKNCLDIGSSTGGFVQILLENQALKIT ALDVGNNQLHLSLRTNEKIILHENTDLRTFKSEEKFELITCDVSFISLINLLYYIDNLAL KEIILLFKPQFEVGKNIKRDKKGVLKDDKAILKARMDFEKACAKLGWLLKNTQKSSIKGK EGNVEYFYYYIKN Click to Show/Hide
|
||||
Function |
Catalyzes the 2'-O-methylation at nucleotide C1920 in 23S rRNA. Enhances motility. Enchances biofilm formation. Involved in the assembly of 70S ribosomes. Involved in virulence by promoting adherence and invasion to host cells. Involved in pathogenicity by modulating secretion of host-protective chemokine interleukin 8 (IL-8). Involved in susceptibility to antibiotic capreomycin.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bordetella pertussis infection | [1] | |||
Resistant Disease | Bordetella pertussis infection [ICD-11: 1C12.0] | |||
Resistant Drug | Erythromycin | |||
Molecule Alteration | Missense mutation | p.A2047G |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Bordetella pertussis isolate | 1952 | ||
Experiment for Molecule Alteration |
Whole genome sequencing assay | |||
Experiment for Drug Resistance |
Disk diffusion assay | |||
Mechanism Description | All of the strains of B. pertussis resistant to erythromycin in our center had the A2047G mutation of the 23S rRNA gene. | |||
Disease Class: Mycoplasma pneumoniae infection | [2] | |||
Resistant Disease | Mycoplasma pneumoniae infection [ICD-11: 1D01.3] | |||
Resistant Drug | Erythromycin | |||
Molecule Alteration | Missense mutation | p.A2063G+p.A2064G+p.A2617G |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Mycoplasma pneumoniae strain | 2014 | ||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | It has been confirmed that drug resistance to macrolide antibiotics of MP is mainly related to the mutation of Gene 23SrRNA in Area V, most commonly in the mutation of A2063G and followed by A2064G and A2617G. Rarely, mutation of ribosomal protein L4 or L22 may induce drug resistance to macrolide antibiotics. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Traveler's diarrhea | [3] | |||
Resistant Disease | Traveler's diarrhea [ICD-11: DA90.1] | |||
Resistant Drug | Zithromax | |||
Molecule Alteration | Missense mutation | p.A2075G |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Campylobacter jejuni isolates | 197 | ||
Campylobacter jejuni ATCC 33560 | 197 | |||
Experiment for Molecule Alteration |
Gene sequencing assay | |||
Experiment for Drug Resistance |
E-test assay | |||
Mechanism Description | Point mutation occurred on the 23S rRNA gene at the A2075G transitions, and the number of mutated gene copies was proportional to azithromycin resistance. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.