General Information of the Molecule (ID: Mol02035)
Name
Vimentin 2, pseudogene (VIM2P) ,Pseudomonas aeruginosa
Synonyms
vim2
    Click to Show/Hide
Molecule Type
Protein
Gene Name
VIM2P
Sequence
MGLPVTRAVSTHFHDDRSPLLGVLRVSGVATYSPPSPRRLAEVEGNEIPTHSLEGLSSSE
VQLPFHPL
    Click to Show/Hide
Uniprot ID
V9W1K1_PSEAI
HGNC ID
HGNC:43891
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: 72274
Family: Pseudomonadaceae
Genus: Pseudomonas
Species: Pseudomonas aeruginosa
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Edetic acid
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] [1]
Sensitive Disease Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
Sensitive Drug Edetic acid
Molecule Alteration Function
Inhibition
Experimental Note Discovered Using In-vivo Testing Model
Experiment for
Molecule Alteration
Molecular modeling assay
Experiment for
Drug Resistance
Double-disk diffusion test assay
Mechanism Description Disk diffusion and broth microdilution methods demonstrate that unithiol inhibits native MBLs NDM-1 and VIM-2 produced by carbapenem-resistant K. pneumoniae and P. aeruginosa bacterial strains.
Unithiol
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] [1]
Sensitive Disease Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
Sensitive Drug Unithiol
Molecule Alteration Function
Inhibition
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Schistosoma mansoni isolates 6183
SH-1-V1 cells Esophagus Homo sapiens (Human) N.A.
Experiment for
Molecule Alteration
Molecular modeling assay
Experiment for
Drug Resistance
Double-disk diffusion test assay
Mechanism Description Disk diffusion and broth microdilution methods demonstrate that unithiol inhibits native MBLs NDM-1 and VIM-2 produced by carbapenem-resistant K. pneumoniae and P. aeruginosa bacterial strains.
References
Ref 1 Drug Repurposing of the Unithiol: Inhibition of Metallo-Beta-Lactamases for the Treatment of Carbapenem-Resistant Gram-Negative Bacterial Infections .Int J Mol Sci. 2022 Feb 6;23(3):1834. doi: 10.3390/ijms23031834. 10.3390/ijms23031834

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.