Molecule Information
General Information of the Molecule (ID: Mol02035)
| Name |
Vimentin 2, pseudogene (VIM2P)
,Pseudomonas aeruginosa
|
||||
|---|---|---|---|---|---|
| Synonyms |
vim2
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
VIM2P
|
||||
| Sequence |
MGLPVTRAVSTHFHDDRSPLLGVLRVSGVATYSPPSPRRLAEVEGNEIPTHSLEGLSSSE
VQLPFHPL Click to Show/Hide
|
||||
| Uniprot ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Sensitive Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
| Sensitive Drug | Edetic acid | |||
| Molecule Alteration | Function | Inhibition |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| Experiment for Molecule Alteration |
Molecular modeling assay | |||
| Experiment for Drug Resistance |
Double-disk diffusion test assay | |||
| Mechanism Description | Disk diffusion and broth microdilution methods demonstrate that unithiol inhibits native MBLs NDM-1 and VIM-2 produced by carbapenem-resistant K. pneumoniae and P. aeruginosa bacterial strains. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Sensitive Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
| Sensitive Drug | Unithiol | |||
| Molecule Alteration | Function | Inhibition |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Schistosoma mansoni isolates | 6183 | ||
| SH-1-V1 cells | Esophagus | Homo sapiens (Human) | N.A. | |
| Experiment for Molecule Alteration |
Molecular modeling assay | |||
| Experiment for Drug Resistance |
Double-disk diffusion test assay | |||
| Mechanism Description | Disk diffusion and broth microdilution methods demonstrate that unithiol inhibits native MBLs NDM-1 and VIM-2 produced by carbapenem-resistant K. pneumoniae and P. aeruginosa bacterial strains. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
