Molecule Information
General Information of the Molecule (ID: Mol02028)
Name |
OXA-23 carbapenemase (BLA OXA-23)
,Acinetobacter baumannii
|
||||
---|---|---|---|---|---|
Synonyms |
ari-1; bla(OXA-23); bla-OXA-23; bla-oxa-23; bla_1; bla_2; bla_3; blaOXA-23; blaOXA23; OXA-23; oxa-23; oxa23; A7M90_19440; ABUW_0563; ACX61_17625; ACX61_20055; AYR68_05160; AYR68_16375; B7L45_15940; B7L45_16275; BAA1790NC_2235; BAA1790NC_2239; BAA1790NC_2243; CBE85_20255; CBL15_02250; CBL15_17480; DLI71_13510; DLI72_20175; DVA69_16975; E2532_00765; E2533_00255; E2534_00245; E2535_00255; E2536_01300; E2538_00225; E2539_00710; E2540_01480; E2541_00230; EA686_06705; EA720_018585; EGM95_08810; F2P40_21140; FDN00_02125; FDN00_19010; FGL68_16065; FJU36_20505; G3N53_19695; GNY86_20740; HB367_12275; HBK86_19320; HBK86_20965; HIN86_20200; IAG11_18825; ITE13_20155; NCTC13421_03368; NCTC13421_03411; NG19_0098; SAMEA104305318_04148; SAMEA104305385_00775
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
BLA OXA-23
|
||||
Gene ID | |||||
Sequence |
MNKYFTCYVVASLFLSGCTVQHNLINETPSQIVQGHNQVIHQYFDEKNTSGVLVIQTDKK
INLYGNALSRANTEYVPASTFKMLNALIGLENQKTDINEIFKWKGEKRSFTAWEKDMTLG EAMKLSAVPVYQELARRIGLDLMQKEVKRIGFGNAEIGQQVDNFWLVGPLKVTPIQEVEF VSQLAHTQLPFSEKVQANVKNMLLLEESNGYKIFGKTGWAMDIKPQVGWLTGWVEQPDGK IVAFALNMEMRSEMPASIRNELLMKSLKQLNII Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
13 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Cutaneous bacterial infection | [1] | |||
Resistant Disease | Cutaneous bacterial infection [ICD-11: 1B21.4] | |||
Resistant Drug | Amikacin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Acinetobacter baumannii isolates | 470 | ||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth microdilution method assay; Agar dilution method assay | |||
Mechanism Description | The isolate was resistant to antibiotics other than ampicillin-sulbactam and colistin, suggesting drug resistance due to carbapenemase production by OXA-23.carbapenem resistance in the isolated carbapenem-resistant A. baumannii strain was at least partially conferred by bla OXA-23-like carbapenemase. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Cutaneous bacterial infection | [1] | |||
Resistant Disease | Cutaneous bacterial infection [ICD-11: 1B21.4] | |||
Resistant Drug | Ampicillin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Acinetobacter baumannii isolates | 470 | ||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth microdilution method assay; Agar dilution method assay | |||
Mechanism Description | The isolate was resistant to antibiotics other than ampicillin-sulbactam and colistin, suggesting drug resistance due to carbapenemase production by OXA-23.carbapenem resistance in the isolated carbapenem-resistant A. baumannii strain was at least partially conferred by bla OXA-23-like carbapenemase. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Cutaneous bacterial infection | [1] | |||
Resistant Disease | Cutaneous bacterial infection [ICD-11: 1B21.4] | |||
Resistant Drug | Cefazolin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Acinetobacter baumannii isolates | 470 | ||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth microdilution method assay; Agar dilution method assay | |||
Mechanism Description | The isolate was resistant to antibiotics other than ampicillin-sulbactam and colistin, suggesting drug resistance due to carbapenemase production by OXA-23.carbapenem resistance in the isolated carbapenem-resistant A. baumannii strain was at least partially conferred by bla OXA-23-like carbapenemase. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Cutaneous bacterial infection | [1] | |||
Resistant Disease | Cutaneous bacterial infection [ICD-11: 1B21.4] | |||
Resistant Drug | Cefepime | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Acinetobacter baumannii isolates | 470 | ||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth microdilution method assay; Agar dilution method assay | |||
Mechanism Description | The isolate was resistant to antibiotics other than ampicillin-sulbactam and colistin, suggesting drug resistance due to carbapenemase production by OXA-23.carbapenem resistance in the isolated carbapenem-resistant A. baumannii strain was at least partially conferred by bla OXA-23-like carbapenemase. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Cutaneous bacterial infection | [1] | |||
Resistant Disease | Cutaneous bacterial infection [ICD-11: 1B21.4] | |||
Resistant Drug | Cefotaxime | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Acinetobacter baumannii isolates | 470 | ||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth microdilution method assay; Agar dilution method assay | |||
Mechanism Description | The isolate was resistant to antibiotics other than ampicillin-sulbactam and colistin, suggesting drug resistance due to carbapenemase production by OXA-23.carbapenem resistance in the isolated carbapenem-resistant A. baumannii strain was at least partially conferred by bla OXA-23-like carbapenemase. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Cutaneous bacterial infection | [1] | |||
Resistant Disease | Cutaneous bacterial infection [ICD-11: 1B21.4] | |||
Resistant Drug | Cefozopran | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Acinetobacter baumannii isolates | 470 | ||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth microdilution method assay; Agar dilution method assay | |||
Mechanism Description | The isolate was resistant to antibiotics other than ampicillin-sulbactam and colistin, suggesting drug resistance due to carbapenemase production by OXA-23.carbapenem resistance in the isolated carbapenem-resistant A. baumannii strain was at least partially conferred by bla OXA-23-like carbapenemase. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Cutaneous bacterial infection | [1] | |||
Resistant Disease | Cutaneous bacterial infection [ICD-11: 1B21.4] | |||
Resistant Drug | Chloramphenicol | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Acinetobacter baumannii isolates | 470 | ||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth microdilution method assay; Agar dilution method assay | |||
Mechanism Description | The isolate was resistant to antibiotics other than ampicillin-sulbactam and colistin, suggesting drug resistance due to carbapenemase production by OXA-23.carbapenem resistance in the isolated carbapenem-resistant A. baumannii strain was at least partially conferred by bla OXA-23-like carbapenemase. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Cutaneous bacterial infection | [1] | |||
Resistant Disease | Cutaneous bacterial infection [ICD-11: 1B21.4] | |||
Resistant Drug | Ciprofloxacin XR | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Acinetobacter baumannii isolates | 470 | ||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth microdilution method assay; Agar dilution method assay | |||
Mechanism Description | The isolate was resistant to antibiotics other than ampicillin-sulbactam and colistin, suggesting drug resistance due to carbapenemase production by OXA-23.carbapenem resistance in the isolated carbapenem-resistant A. baumannii strain was at least partially conferred by bla OXA-23-like carbapenemase. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Cutaneous bacterial infection | [1] | |||
Resistant Disease | Cutaneous bacterial infection [ICD-11: 1B21.4] | |||
Resistant Drug | Co-trimoxazole | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Acinetobacter baumannii isolates | 470 | ||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth microdilution method assay; Agar dilution method assay | |||
Mechanism Description | The isolate was resistant to antibiotics other than ampicillin-sulbactam and colistin, suggesting drug resistance due to carbapenemase production by OXA-23.carbapenem resistance in the isolated carbapenem-resistant A. baumannii strain was at least partially conferred by bla OXA-23-like carbapenemase. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Cutaneous bacterial infection | [1] | |||
Resistant Disease | Cutaneous bacterial infection [ICD-11: 1B21.4] | |||
Resistant Drug | Gentamicin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Acinetobacter baumannii isolates | 470 | ||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth microdilution method assay; Agar dilution method assay | |||
Mechanism Description | The isolate was resistant to antibiotics other than ampicillin-sulbactam and colistin, suggesting drug resistance due to carbapenemase production by OXA-23.carbapenem resistance in the isolated carbapenem-resistant A. baumannii strain was at least partially conferred by bla OXA-23-like carbapenemase. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Cutaneous bacterial infection | [1] | |||
Resistant Disease | Cutaneous bacterial infection [ICD-11: 1B21.4] | |||
Resistant Drug | Levofloxacin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Acinetobacter baumannii isolates | 470 | ||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth microdilution method assay; Agar dilution method assay | |||
Mechanism Description | The isolate was resistant to antibiotics other than ampicillin-sulbactam and colistin, suggesting drug resistance due to carbapenemase production by OXA-23.carbapenem resistance in the isolated carbapenem-resistant A. baumannii strain was at least partially conferred by bla OXA-23-like carbapenemase. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Cutaneous bacterial infection | [1] | |||
Resistant Disease | Cutaneous bacterial infection [ICD-11: 1B21.4] | |||
Resistant Drug | Meropenem | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Acinetobacter baumannii isolates | 470 | ||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth microdilution method assay; Agar dilution method assay | |||
Mechanism Description | The isolate was resistant to antibiotics other than ampicillin-sulbactam and colistin, suggesting drug resistance due to carbapenemase production by OXA-23.carbapenem resistance in the isolated carbapenem-resistant A. baumannii strain was at least partially conferred by bla OXA-23-like carbapenemase. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Cutaneous bacterial infection | [1] | |||
Resistant Disease | Cutaneous bacterial infection [ICD-11: 1B21.4] | |||
Resistant Drug | Piperacillin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Acinetobacter baumannii isolates | 470 | ||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth microdilution method assay; Agar dilution method assay | |||
Mechanism Description | The isolate was resistant to antibiotics other than ampicillin-sulbactam and colistin, suggesting drug resistance due to carbapenemase production by OXA-23.carbapenem resistance in the isolated carbapenem-resistant A. baumannii strain was at least partially conferred by bla OXA-23-like carbapenemase. |
Investigative Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Cutaneous bacterial infection | [1] | |||
Resistant Disease | Cutaneous bacterial infection [ICD-11: 1B21.4] | |||
Resistant Drug | Flomoxef | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Acinetobacter baumannii isolates | 470 | ||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth microdilution method assay; Agar dilution method assay | |||
Mechanism Description | The isolate was resistant to antibiotics other than ampicillin-sulbactam and colistin, suggesting drug resistance due to carbapenemase production by OXA-23.carbapenem resistance in the isolated carbapenem-resistant A. baumannii strain was at least partially conferred by bla OXA-23-like carbapenemase. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.