Molecule Information
General Information of the Molecule (ID: Mol02024)
Name |
Metallo-beta-lactamase type 2 (BLAN1)
,Klebsiella pneumoniae
|
||||
---|---|---|---|---|---|
Synonyms |
blaNDM-1
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
BLAN1
|
||||
Gene ID | |||||
Sequence |
MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQ
HTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTH AHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPL KVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAF PKASMIVMSHSAPDSRAAITHTARMADKLR Click to Show/Hide
|
||||
Function |
Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring. Does not confer resistance to the polymixin colistin or the fluoroquinolone ciprofloxacin.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Klebsiella pneumoniae infection | [1] | |||
Sensitive Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
Sensitive Drug | Edetic acid | |||
Molecule Alteration | Function | Inhibition |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
Experiment for Molecule Alteration |
Molecular modeling assay | |||
Experiment for Drug Resistance |
Double-disk diffusion test assay | |||
Mechanism Description | Disk diffusion and broth microdilution methods demonstrate that unithiol inhibits native MBLs NDM-1 and VIM-2 produced by carbapenem-resistant K. pneumoniae and P. aeruginosa bacterial strains. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Klebsiella pneumoniae infection | [1] | |||
Sensitive Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
Sensitive Drug | Unithiol | |||
Molecule Alteration | Function | Inhibition |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Klebsiella pneumoniae strain 409 | 573 | ||
Klebsiella pneumoniae strain 410 | 573 | |||
Experiment for Molecule Alteration |
Molecular modeling assay | |||
Experiment for Drug Resistance |
Double-disk diffusion test assay | |||
Mechanism Description | Disk diffusion and broth microdilution methods demonstrate that unithiol inhibits native MBLs NDM-1 and VIM-2 produced by carbapenem-resistant K. pneumoniae and P. aeruginosa bacterial strains. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.