Molecule Information
      General Information of the Molecule (ID: Mol02014)
  
  | Name | Multidrug resistance protein MdtE (MDTE)
                                ,Trichomonas vaginalis
                               | ||||
|---|---|---|---|---|---|
| Synonyms | TVAG_572140     Click to Show/Hide | ||||
| Molecule Type | Protein | ||||
| Gene Name | MDTE | ||||
| Gene ID | |||||
| Sequence | MSNNIKLVVVGDGAVGKTCLLVVYARNEFPSEYVPTVFDNYTAKVKIDDTLYPVQLWDTA GQEELENIRTLSYQNTSVFLLCFSVTTPTTFDNLTTVWIPEIKRYVKNPEILLIGTKADL RNDEQTLKNLEADGKAPITLEQAQQKAKEIGAIAYCECSALKNEGVREAFDKAINHIIEK DNGGCCHLI     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      1 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Trichomoniasis | [1] | |||
| Resistant Disease | Trichomoniasis [ICD-11: 1A92.0] | |||
| Resistant Drug | Metronidazole | |||
| Molecule Alteration | Expression | Up-regulation | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Trichomonas vaginalis ATCC 30001 | 5722 | ||
| Trichomonas vaginalis ATCC 30236 | 5722 | |||
| Trichomonas vaginalis ATCC50148 | 5722 | |||
| Trichomonas vaginalis ATCC 50142 | 5722 | |||
| Trichomonas vaginalis ATCC 50143 | 5722 | |||
| Trichomonas vaginalis ATCC 30238 | 5722 | |||
| Experiment for Molecule Alteration | Gene sequencing assay | |||
| Experiment for Drug Resistance | Trypan blue exclusion assay | |||
| Mechanism Description | Comparative transcriptomes analysis identified that several putative drug-resistant genes were exclusively upregulated in different MTZ-R strains, such as ATP-binding cassette (ABC) transporters and multidrug resistance pumps. | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
