Molecule Information

General Information of the Molecule (ID: Mol02013)

• Name: Aminoacyltransferase FemB (FEMB) ,Staphylococcus aureus
• Synonyms: femB; SAOUHSC_01374
• Molecule Type: Protein
• Gene Name: FEMB
• Gene ID: 3920783
• Sequence:
  MKFTELTVTEFDNFVQNPSLESHYFQVKENIVTRENDGFEVVLLGIKDDNNKVIAASLFS
  KIPTMGSYVYYSNRGPVMDFSDLGLVDYYLKELDKYLQQHQCLYVKLDPYWLYHLYDKDI
  VPFEGREKNDALVNLFKSHGYEHHGFTTEYDTSSQVRWMGVLNLEGKTPETLKKTFDSQR
  KRNINKAINYGVKVRFLERDEFNLFLDLYRETEERAGFVSKTDDYFYNFIDTYGDKVLVP
  LAYIDLDEYVLKLQQELNDKENRRDQMMAKENKSDKQMKKIAELDKQIDHDQHELLNASE
  LSKTDGPILNLASGVYFANAYEVNYFSGGSSEKYNQFMGPYMMHWFMINYCFDNGYDRYN
  FYGLSGDFTENSEDYGVYRFKRGFNVQIEELIGDFYKPIHKVKYWLFTTLDKLRKKLKK
• Function: Catalyzes the formation of the pentaglycine interpeptide bridge, which is characteristic of the S.aureus peptidoglycan. Adds glycines 4 and 5 of the pentaglycine bridge, using glycyl-tRNA(Gly) as donor. Involved in resistance to methicillin.
• Uniprot ID: FEMB_STAA8

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: 1385
Family: Staphylococcaceae
Genus: Staphylococcus
Species: Staphylococcus aureus

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Diclofenac

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Staphylococcus aureus infection [1]

• Sensitive Disease: Staphylococcus aureus infection [ICD-11: 1B54.0]
• Sensitive Drug: Diclofenac
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• Cell Pathway Regulation: mecA/blaZ pathway; Activation; hsa01501
• In Vivo Model: Murine skin and soft tissue infection model; Mus musculus
• Experiment for Molecule Alteration: Gene expression analysis; Cellular ATP level assay; Ethidium bromide efflux inhibition assay
• Experiment for Drug Resistance: CCK-8 assay
• Mechanism Description: High-dose diclofenac can inhibit the growth of MRSA, and does not easily induce drug-resistant mutations after continuous passage. Low-doses diclofenac can resensitize bacteria to beta-lactams, which help to circumvent drug resistance and improve the antibacterial efficacy of conventional antibiotics. Diclofenac can reduce the expression of genes and proteins associated with beta-lactam resistance, low dose diclofenac can inhibit MRSA antibiotic resistance via the mecA/blaZ pathway and related biofilms in implants.

References

• Ref 1: Diclofenac Resensitizes Methicillin-Resistant Staphylococcus aureus to Beta-Lactams and Prevents Implant Infections .Adv Sci (Weinh). 2021 May 3;8(13):2100681. doi: 10.1002/advs.202100681. eCollection 2021 Jul. 10.1002/advs.202100681