Molecule Information
General Information of the Molecule (ID: Mol01989)
Name |
Ceramide synthase 6 (CERS6)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
CERS6; LASS6
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
CERS6
|
||||
Gene ID | |||||
Location |
chr2:168,456,249-168,775,134[+]
|
||||
Sequence |
MAGILAWFWNERFWLPHNVTWADLKNTEEATFPQAEDLYLAFPLAFCIFMVRLIFERFVA
KPCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQR RNQEKPSTLTRFCESMWRFSFYLYVFTYGVRFLKKTPWLWNTRHCWYNYPYQPLTTDLHY YYILELSFYWSLMFSQFTDIKRKDFGIMFLHHLVSIFLITFSYVNNMARVGTLVLCLHDS ADALLEAAKMANYAKFQKMCDLLFVMFAVVFITTRLGIFPLWVLNTTLFESWEIVGPYPS WWVFNLLLLLVQGLNCFWSYLIVKIACKAVSRGKVSKDDRSDIESSSDEEDSEPPGKNPH TATTTNGTSGTNGYLLTGSCSMDD Click to Show/Hide
|
||||
Function |
Ceramide synthase that catalyzes the transfer of the acyl chain from acyl-CoA to a sphingoid base, with high selectivity toward palmitoyl-CoA (hexadecanoyl-CoA; C16:0-CoA). Can use other acyl donors, but with less efficiency. N-acylates sphinganine and sphingosine bases to form dihydroceramides and ceramides in de novo synthesis and salvage pathways, respectively. Ceramides generated by CERS6 play a role in inflammatory response. Acts as a regulator of metabolism and hepatic lipid accumulation. Under high fat diet, palmitoyl- (C16:0-) ceramides generated by CERS6 specifically bind the mitochondrial fission factor MFF, thereby promoting mitochondrial fragmentation and contributing to the development of obesity.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Type 2 diabetes mellitus | [1] | |||
Sensitive Disease | Type 2 diabetes mellitus [ICD-11: 5A11.0] | |||
Sensitive Drug | Insulin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Mechanism Description | Also, liver-specific knock out of ceramide synthase 6 (CerS6) decreased hepatic ceramide levels (especially C16:0 species), protected against HFD-induced obesity, and improved glucose tolerance. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 05
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Omental adipose tissue | |
The Specified Disease | Obesity related type 2 diabetes | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.31E-01; Fold-change: 1.66E-02; Z-score: 1.61E-01 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Liver | |
The Specified Disease | Type 2 diabetes mellitus | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.37E-02; Fold-change: 3.58E-01; Z-score: 1.27E+00 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
![]() |
||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.