Molecule Information
General Information of the Molecule (ID: Mol01988)
Name |
Tribbles homolog 3 (TRIB3)
,Mus musculus
|
||||
---|---|---|---|---|---|
Synonyms |
Trib3; Nipk; Trb3
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
TRIB3
|
||||
Gene ID | |||||
Location |
chr2:152,179,342-152,185,952[-]
|
||||
Sequence |
MRATPLAASADVSCRKKPLEFDDNIDAKCPVLKRVRDEPEPGPLPSLLPPSPPPASDLSP
AVAPATRLGPYILLEREQGSCSYRALHCPTGTEYTCKVYPASEAQAVLAPYARLPTHQHV ARPTEVLLGSRLLYIFFTKTHGDLHSLVRSRRGIPESEAAGLFRQMASAVAHCHKHGLVL RDLKLRRFVFSNCERTKLVLENLEDACVMTGSDDSLWDKHACPAYVGPEILSSRPSYSGK AADVWSLGVALFTMLAGRYPFHDSEPVLLFGKIRRGTFALPEGLSAPARCLIRCLLRKEP SERLVALGILLHPWLREDHGRVSPPQSDRREMDQVVPDGPQLEEAEEGEVGLYG Click to Show/Hide
|
||||
Function |
Inactive protein kinase which acts as a regulator of the integrated stress response (ISR), a process for adaptation to various stress. Inhibits the transcriptional activity of DDIT3/CHOP and is involved in DDIT3/CHOP-dependent cell death during ER stress. May play a role in programmed neuronal cell death but does not appear to affect non-neuronal cells. Acts as a negative feedback regulator of the ATF4-dependent transcription during the ISR: while TRIB3 expression is promoted by ATF4, TRIB3 protein interacts with ATF4 and inhibits ATF4 transcription activity. Disrupts insulin signaling by binding directly to Akt kinases and blocking their activation. May bind directly to and mask the 'Thr-308' phosphorylation site in AKT1. Interacts with the NF-kappa-B transactivator p65 RELA and inhibits its phosphorylation and thus its transcriptional activation activity. Interacts with MAPK kinases and regulates activation of MAP kinases. Can inhibit APOBEC3A editing of nuclear DNA.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Insulin-resistance syndrome | [1] | |||
Sensitive Disease | Insulin-resistance syndrome [ICD-11: 5A44.0] | |||
Sensitive Drug | Nicorandil | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
Cell Pathway Regulation | PERK signaling pathway | Inhibition | hsa04137 | |
In Vitro Model | L6 cells | Skeletal muscle | Rattus norvegicus (Rat) | CVCL_0385 |
In Vivo Model | Adult Sprague-Dawley rats model | Rattus norvegicus | ||
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
Glucose tolerance test, insulin tolerance test | |||
Mechanism Description | Nicorandil attenuates high glucose-induced insulin resistance by suppressing oxidative stress-mediated ER stress PERK signaling pathway. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.