Molecule Information
General Information of the Molecule (ID: Mol01986)
| Name |
Serine palmitoyltransferase small subunit B (SPTSB)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
SPTSSB; ADMP; C3orf57; SSSPTB
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
SPTSB
|
||||
| Gene ID | |||||
| Location |
chr3:161,344,798-161,372,880[-]
|
||||
| Sequence |
MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLA
WEFFSKICGYHSTISN Click to Show/Hide
|
||||
| Function |
Stimulates the activity of serine palmitoyltransferase (SPT). The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference, complexes with this subunit showing a clear preference for longer acyl-CoAs. The SPTLC1-SPTLC2-SPTSSB complex shows a strong preference for C18-CoA substrate, while the SPTLC1-SPTLC3-SPTSSB isozyme displays an ability to use a broader range of acyl-CoAs, without apparent preference. May play a role in signal transduction.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Type 2 diabetes mellitus | [1] | |||
| Resistant Disease | Type 2 diabetes mellitus [ICD-11: 5A11.0] | |||
| Resistant Drug | Insulin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Mechanism Description | Obese rats with insulin resistance have consistently been reported to exhibit elevated hepatic and muscle ceramide contents. Inhibition of ceramide synthesis using myriocin, an inhibitor of serine palmitoyltransferase, prevented insulin resistance and attenuated ceramide contents in fat-fed mice. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Type 2 diabetes mellitus | [1] | |||
| Sensitive Disease | Type 2 diabetes mellitus [ICD-11: 5A11.0] | |||
| Sensitive Drug | Insulin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Mechanism Description | Obese rats with insulin resistance have consistently been reported to exhibit elevated hepatic and muscle ceramide contents. Inhibition of ceramide synthesis using myriocin, an inhibitor of serine palmitoyltransferase, prevented insulin resistance and attenuated ceramide contents in fat-fed mice. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 05
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Omental adipose tissue | |
| The Specified Disease | Obesity related type 2 diabetes | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 8.15E-01; Fold-change: 3.22E-02; Z-score: 4.24E-01 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Liver | |
| The Specified Disease | Type 2 diabetes mellitus | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.95E-01; Fold-change: -2.01E-02; Z-score: -7.56E-02 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
