Molecule Information

General Information of the Molecule (ID: Mol01963)

Name	Sclerostin (SOST) ,Homo sapiens
Synonyms	SOST; UNQ2976/PRO7455/PRO7476 Click to Show/Hide
Molecule Type	Protein
Gene Name	SOST
Gene ID	50964
Location	chr17:43,753,738-43,758,791[-]
Sequence	MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAE NGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIG RGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELK DFGTEAARPQKGRKPRPRARSAKANQAELENAY Click to Show/Hide
Function	Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation. Click to Show/Hide
Uniprot ID	SOST_HUMAN
Ensembl ID	ENSG00000167941
HGNC ID	HGNC:13771
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Pyrvinium

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Anaplastic thyroid cancer				[1]
Sensitive Disease	Anaplastic thyroid cancer [ICD-11: 2D10.2]			Disease Info
Sensitive Drug	Pyrvinium			Drug Info
Molecule Alteration	Expression		Up-regulation
Experimental Note	Revealed Based on the Cell Line Data
Cell Pathway Regulation	Wnt signaling pathway		Activation	hsa04310
In Vitro Model	LNCaP cells	Prostate	Homo sapiens (Human)	CVCL_0395
	HCT116 cells	Colon	Homo sapiens (Human)	CVCL_0291
Experiment for Molecule Alteration	Western blotting analysis; ART sensitivity assay
Experiment for Drug Resistance	CCK-8 cell proliferation assay; Flow cytometry
Mechanism Description	Pyrvinium pamoate can overcome artemisinin's resistance in anaplastic thyroid cancer. The resistance of CAL-62 to ART was related to the upregulation of the WNT signaling pathway.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Click to Show/Hide the Resistance Disease of This Class

Thyroid cancer [ICD-11: 2D10]

Click to Show/Hide

Differential expression of molecule in resistant diseases
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.33E-05; Fold-change: -1.02E-01; Z-score: -1.70E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.99E-02; Fold-change: -4.74E-02; Z-score: -1.25E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances		Click to View the Clearer Original Diagram
Download Molecule expression barchart for all samples Download Molecule expression data of patients in the normal section of the tissue adjacent to the disease section Download Molecule expression data of patients in the disease section of the tissue Download Molecule expression data in the tissue of healthy individual

References

Ref 1	Pyrvinium pamoate can overcome artemisinin's resistance in anaplastic thyroid cancer .BMC Complement Med Ther. 2021 May 28;21(1):156. doi: 10.1186/s12906-021-03332-z. 10.1186/s12906-021-03332-z