General Information of the Molecule (ID: Mol01958)
Name
TNF alpha induced protein 8 (TNFAIP8) ,Homo sapiens
Synonyms
TNFAIP8
    Click to Show/Hide
Molecule Type
Protein
Gene Name
TNFAIP8
Gene ID
25816
Location
chr5:119,268,692-119,399,688[+]
Sequence
MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTRE
YTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVD
YTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKP
HLQKLCDGINKMLDEENI
    Click to Show/Hide
Function
Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.
    Click to Show/Hide
Uniprot ID
TFIP8_HUMAN
Ensembl ID
ENSG00000145779
HGNC ID
HGNC:17260
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Sorafenib
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Hepatic Steatosis [1]
Resistant Disease Hepatic Steatosis [ICD-11: DB92.Y]
Resistant Drug Sorafenib
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation AKT/mTOR signaling pathway Inhibition hsa04150
In Vitro Model HepG2 cells Liver Homo sapiens (Human) CVCL_0027
Hep3B cells Liver Homo sapiens (Human) CVCL_0326
SK-Hep1 cells Ascites Homo sapiens (Human) CVCL_0525
PLC/PRF/5 cells Liver Homo sapiens (Human) CVCL_0485
In Vivo Model C57BL/6J mice Mus musculus
Experiment for
Molecule Alteration
Western blotting analysis; RT/qPCR
Experiment for
Drug Resistance
MTT assay
Mechanism Description Increased TNFAIP8 levels in HCC cells enhanced cell survival by blocking apoptosis, rendering HCC cells more resistant to the anticancer drugs, sorafenib and regorafenib. TNFAIP8 also induced autophagy and steatosis in liver cancer cells. Consistent with these observations, TNFAIP8 blocked AKT/mTOR signaling and showed direct interaction with ATG3-ATG7 proteins.
Disease Class: Hepatic Steatosis [1]
Resistant Disease Hepatic Steatosis [ICD-11: DB92.Y]
Resistant Drug Sorafenib
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation AKT/mTOR signaling pathway Inhibition hsa04150
In Vitro Model HepG2 cells Liver Homo sapiens (Human) CVCL_0027
Hep3B cells Liver Homo sapiens (Human) CVCL_0326
SK-Hep1 cells Ascites Homo sapiens (Human) CVCL_0525
PLC/PRF/5 cells Liver Homo sapiens (Human) CVCL_0485
In Vivo Model C57BL/6J mice Mus musculus
Experiment for
Molecule Alteration
Western blotting analysis; RT/qPCR
Experiment for
Drug Resistance
MTT assay
Mechanism Description Increased TNFAIP8 levels in HCC cells enhanced cell survival by blocking apoptosis, rendering HCC cells more resistant to the anticancer drugs, sorafenib and regorafenib. TNFAIP8 also induced autophagy and steatosis in liver cancer cells. Consistent with these observations, TNFAIP8 blocked AKT/mTOR signaling and showed direct interaction with ATG3-ATG7 proteins.
Disease Class: Hepatic Steatosis [1]
Resistant Disease Hepatic Steatosis [ICD-11: DB92.Y]
Resistant Drug Sorafenib
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation AKT/mTOR signaling pathway Inhibition hsa04150
In Vitro Model HepG2 cells Liver Homo sapiens (Human) CVCL_0027
Hep3B cells Liver Homo sapiens (Human) CVCL_0326
SK-Hep1 cells Ascites Homo sapiens (Human) CVCL_0525
PLC/PRF/5 cells Liver Homo sapiens (Human) CVCL_0485
In Vivo Model C57BL/6J mice Mus musculus
Experiment for
Molecule Alteration
Western blotting analysis; RT/qPCR
Experiment for
Drug Resistance
MTT assay
Mechanism Description Increased TNFAIP8 levels in HCC cells enhanced cell survival by blocking apoptosis, rendering HCC cells more resistant to the anticancer drugs, sorafenib and regorafenib. TNFAIP8 also induced autophagy and steatosis in liver cancer cells. Consistent with these observations, TNFAIP8 blocked AKT/mTOR signaling and showed direct interaction with ATG3-ATG7 proteins.
Disease Class: Hepatic Steatosis [1]
Resistant Disease Hepatic Steatosis [ICD-11: DB92.Y]
Resistant Drug Sorafenib
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation AKT/mTOR signaling pathway Inhibition hsa04150
In Vitro Model HepG2 cells Liver Homo sapiens (Human) CVCL_0027
Hep3B cells Liver Homo sapiens (Human) CVCL_0326
SK-Hep1 cells Ascites Homo sapiens (Human) CVCL_0525
PLC/PRF/5 cells Liver Homo sapiens (Human) CVCL_0485
In Vivo Model C57BL/6J mice Mus musculus
Experiment for
Molecule Alteration
Western blotting analysis; RT/qPCR
Experiment for
Drug Resistance
MTT assay
Mechanism Description Increased TNFAIP8 levels in HCC cells enhanced cell survival by blocking apoptosis, rendering HCC cells more resistant to the anticancer drugs, sorafenib and regorafenib. TNFAIP8 also induced autophagy and steatosis in liver cancer cells. Consistent with these observations, TNFAIP8 blocked AKT/mTOR signaling and showed direct interaction with ATG3-ATG7 proteins.
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 13
Click to Show/Hide the Resistance Disease of This Class
Nonalcoholic fatty liver disease [ICD-11: DB92]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Liver
The Specified Disease Nonalcoholic fatty liver disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.88E-02; Fold-change: 8.58E-01; Z-score: 1.11E+00
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 TNFAIP8 regulates autophagy, cell steatosis, and promotes hepatocellular carcinoma cell proliferation .Cell Death Dis. 2020 Mar 9;11(3):178. doi: 10.1038/s41419-020-2369-4. 10.1038/s41419-020-2369-4
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.