Molecule Information
General Information of the Molecule (ID: Mol01954)
| Name |
Quinolinate phosphoribosyltransferase (QPRT)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
QPRT
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
QPRT
|
||||
| Gene ID | |||||
| Location |
chr16:29,663,279-29,698,699[+]
|
||||
| Sequence |
MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGVLAGQPFF
DAIFTQLNCQVSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAA AVEAARGAGWTGHVAGTRKTTPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGG VEKAVRAARQAADFTLKVEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQF PSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKIH Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Involved in the catabolism of quinolinic acid (QA).
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Glioma [ICD-11: 2A00.1] | [1] | |||
| Resistant Disease | Glioma [ICD-11: 2A00.1] | |||
| Resistant Drug | Panobinostat | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Brain cancer [ICD-11: 2A00] | |||
| The Specified Disease | Glioma | |||
| The Studied Tissue | Brainstem tissue | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.83E-01 Fold-change: 1.51E-03 Z-score: 2.53E-02 |
|||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
| In Vitro Model | ES-2 cells | Ovary | Homo sapiens (Human) | CVCL_3509 |
| MG-63 cells | Bone | Homo sapiens (Human) | CVCL_0426 | |
| MMQ cells | Pituitary gland | Rattus norvegicus (Rat) | CVCL_2117 | |
| MOLM-13 cells | Peripheral blood | Homo sapiens (Human) | CVCL_2119 | |
| MOLM-14 cells | Peripheral blood | Homo sapiens (Human) | CVCL_7916 | |
| SH-1-V8 cells | Esophagus | Homo sapiens (Human) | N.A. | |
| Experiment for Molecule Alteration |
Western blot analysis; RNA-sequencing analysis | |||
| Experiment for Drug Resistance |
Flow cytometry | |||
| Mechanism Description | RNA-sequencing identifies quinolinic acid phosphoribosyltransferase (QPRT) as a highly expressed gene in bortezomib-panobinostat resistant U87 cells. QPRT, an enzyme catalyzing the rate-determining conversion of quinolinic acid (QA) to nicotinic acid mononucleotide (NAMN) a precursor for de novo NAD+ biosynthesis from tryptophan. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Nervous tissue | |
| The Specified Disease | Brain cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.46E-03; Fold-change: 1.07E-01; Z-score: 2.75E-01 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Brainstem tissue | |
| The Specified Disease | Glioma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.83E-01; Fold-change: 2.70E-02; Z-score: 7.86E-02 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | White matter | |
| The Specified Disease | Glioma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.62E-06; Fold-change: -6.01E-01; Z-score: -2.87E+00 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Brainstem tissue | |
| The Specified Disease | Neuroectodermal tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.08E-05; Fold-change: -1.08E+00; Z-score: -2.67E+00 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
