General Information of the Molecule (ID: Mol01954)
Name
Quinolinate phosphoribosyltransferase (QPRT) ,Homo sapiens
Synonyms
QPRT
    Click to Show/Hide
Molecule Type
Protein
Gene Name
QPRT
Gene ID
23475
Location
chr16:29,663,279-29,698,699[+]
Sequence
MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGVLAGQPFF
DAIFTQLNCQVSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAA
AVEAARGAGWTGHVAGTRKTTPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGG
VEKAVRAARQAADFTLKVEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQF
PSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKIH
    Click to Show/Hide
Function
Involved in the catabolism of quinolinic acid (QA).
    Click to Show/Hide
Uniprot ID
NADC_HUMAN
Ensembl ID
ENSG00000103485
HGNC ID
HGNC:9755
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Panobinostat
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Glioma [1]
Resistant Disease Glioma [ICD-11: 2A00.1]
Resistant Drug Panobinostat
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell apoptosis Inhibition hsa04210
In Vitro Model ES-2 cells Ovary Homo sapiens (Human) CVCL_3509
MG-63 cells Bone Homo sapiens (Human) CVCL_0426
MMQ cells Pituitary gland Rattus norvegicus (Rat) CVCL_2117
MOLM-13 cells Peripheral blood Homo sapiens (Human) CVCL_2119
MOLM-14 cells Peripheral blood Homo sapiens (Human) CVCL_7916
SH-1-V8 cells Esophagus Homo sapiens (Human) N.A.
Experiment for
Molecule Alteration
Western blotting analysis; RNA-sequencing analysis
Experiment for
Drug Resistance
Flow cytometry
Mechanism Description RNA-sequencing identifies quinolinic acid phosphoribosyltransferase (QPRT) as a highly expressed gene in bortezomib-panobinostat resistant U87 cells. QPRT, an enzyme catalyzing the rate-determining conversion of quinolinic acid (QA) to nicotinic acid mononucleotide (NAMN) a precursor for de novo NAD+ biosynthesis from tryptophan.
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Click to Show/Hide the Resistance Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Nervous tissue
The Specified Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.46E-03; Fold-change: 1.07E-01; Z-score: 2.75E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem tissue
The Specified Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.83E-01; Fold-change: 2.70E-02; Z-score: 7.86E-02
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specified Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.62E-06; Fold-change: -6.01E-01; Z-score: -2.87E+00
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem tissue
The Specified Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.08E-05; Fold-change: -1.08E+00; Z-score: -2.67E+00
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 Targeting NAD(+) Biosynthesis Overcomes Panobinostat and Bortezomib-Induced Malignant Glioma Resistance .Mol Cancer Res. 2020 Jul;18(7):1004-1017. doi: 10.1158/1541-7786.MCR-19-0669. Epub 2020 Apr 1. 10.1158/1541-7786.MCR-19-0669
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.