Molecule Information
General Information of the Molecule (ID: Mol01954)
Name |
Quinolinate phosphoribosyltransferase (QPRT)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
QPRT
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
QPRT
|
||||
Gene ID | |||||
Location |
chr16:29,663,279-29,698,699[+]
|
||||
Sequence |
MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGVLAGQPFF
DAIFTQLNCQVSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAA AVEAARGAGWTGHVAGTRKTTPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGG VEKAVRAARQAADFTLKVEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQF PSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKIH Click to Show/Hide
|
||||
Function |
Involved in the catabolism of quinolinic acid (QA).
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Glioma | [1] | |||
Resistant Disease | Glioma [ICD-11: 2A00.1] | |||
Resistant Drug | Panobinostat | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
In Vitro Model | ES-2 cells | Ovary | Homo sapiens (Human) | CVCL_3509 |
MG-63 cells | Bone | Homo sapiens (Human) | CVCL_0426 | |
MMQ cells | Pituitary gland | Rattus norvegicus (Rat) | CVCL_2117 | |
MOLM-13 cells | Peripheral blood | Homo sapiens (Human) | CVCL_2119 | |
MOLM-14 cells | Peripheral blood | Homo sapiens (Human) | CVCL_7916 | |
SH-1-V8 cells | Esophagus | Homo sapiens (Human) | N.A. | |
Experiment for Molecule Alteration |
Western blotting analysis; RNA-sequencing analysis | |||
Experiment for Drug Resistance |
Flow cytometry | |||
Mechanism Description | RNA-sequencing identifies quinolinic acid phosphoribosyltransferase (QPRT) as a highly expressed gene in bortezomib-panobinostat resistant U87 cells. QPRT, an enzyme catalyzing the rate-determining conversion of quinolinic acid (QA) to nicotinic acid mononucleotide (NAMN) a precursor for de novo NAD+ biosynthesis from tryptophan. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Nervous tissue | |
The Specified Disease | Brain cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.46E-03; Fold-change: 1.07E-01; Z-score: 2.75E-01 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Brainstem tissue | |
The Specified Disease | Glioma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.83E-01; Fold-change: 2.70E-02; Z-score: 7.86E-02 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | White matter | |
The Specified Disease | Glioma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.62E-06; Fold-change: -6.01E-01; Z-score: -2.87E+00 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Brainstem tissue | |
The Specified Disease | Neuroectodermal tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.08E-05; Fold-change: -1.08E+00; Z-score: -2.67E+00 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
![]() |
||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.