Molecule Information
General Information of the Molecule (ID: Mol01950)
| Name |
Glial fibrillary acidic protein (GFAP)
,Mus musculus
|
||||
|---|---|---|---|---|---|
| Synonyms |
Gfap
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
GFAP
|
||||
| Gene ID | |||||
| Location |
chr11:102,778,162-102,791,738[-]
|
||||
| Sequence |
MERRRITSARRSYASETVVRGLGPSRQLGTMPRFSLSRMTPPLPARVDFSLAGALNAGFK
ETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELREL RLRLDQLTANSARLEVERDNFAQDLGTLRQKLQDETNLRLEAENNLAAYRQEADEATLAR VDLERKVESLEEEIQFLRKIYEEEVRELREQLAQQQVHVEMDVAKPDLTAALREIRTQYE AVATSNMQETEEWYRSKFADLTDAASRNAELLRQAKHEANDYRRQLQALTCDLESLRGTN ESLERQMREQEERHARESASYQEALARLEEEGQSLKEEMARHLQEYQDLLNVKLALDIEI ATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKD SKQEHKDVVM Click to Show/Hide
|
||||
| Function |
GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Glioma [ICD-11: 2A00.1] | [1] | |||
| Sensitive Disease | Glioma [ICD-11: 2A00.1] | |||
| Sensitive Drug | Rabeprazole | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Brain cancer [ICD-11: 2A00] | |||
| The Specified Disease | Glioma | |||
| The Studied Tissue | Nervous tissue | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.94E-11 Fold-change: 9.69E-01 Z-score: 1.04E+01 |
|||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| Cell Pathway Regulation | AKT/GSK3beta signaling pathway | Inhibition | hsa04931 | |
| NF-KappaB signaling pathway | Inhibition | hsa04064 | ||
| In Vitro Model | MDA-231 cells | Pleural effusion | Homo sapiens (Human) | CVCL_0062 |
| MJ cells | Peripheral blood | Homo sapiens (Human) | CVCL_1414 | |
| MMQ cells | Pituitary gland | Rattus norvegicus (Rat) | CVCL_2117 | |
| MOLM-13 cells | Peripheral blood | Homo sapiens (Human) | CVCL_2119 | |
| In Vivo Model | Male Wistar rats-Stereotaxic glioma model | Rattus norvegicus | ||
| Experiment for Molecule Alteration |
Western blot analysis; Gene expression analysis | |||
| Experiment for Drug Resistance |
MTT assay; Scratch wound healing migration assay; Transwell invasion assay | |||
| Mechanism Description | Epithelial to mesenchymal transition (EMT) is pivotal in embryonic development and wound healing, whereas in cancer it inflicts malignancy and drug resistance. Rabeprazole has efficacy per se and reduces resistance to temozolomide in glioma via EMT inhibition. Rabeprazole suppressed EMT by impeding AKT/GSK3beta phosphorylation and/or NF-kappaB signaling and sensitized temozolomide resistance. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
