Molecule Information
General Information of the Molecule (ID: Mol01949)
Name |
C-C motif chemokine receptor 5 (CCR5)
,Mus musculus
|
||||
---|---|---|---|---|---|
Synonyms |
Ccr5; Cmkbr5
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
CCR5
|
||||
Gene ID | |||||
Location |
chr9:123,921,580-123,947,736[+]
|
||||
Sequence |
MDFQGSVPTYSYDIDYGMSAPCQKINVKQIAAQLLPPLYSLVFIFGFVGNMMVFLILISC
KKLKSVTDIYLLNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKVFTGLYHIGYFGGIFF IILLTIDRYLAIVHAVFALKVRTVNFGVITSVVTWAVAVFASLPEIIFTRSQKEGFHYTC SPHFPHTQYHFWKSFQTLKMVILSLILPLLVMVICYSGILHTLFRCRNEKKRHRAVRLIF AIMIVYFLFWTPYNIVLLLTTFQEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYA FVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL Click to Show/Hide
|
||||
Function |
Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Participates in T-lymphocyte migration to the infection site by acting as a chemotactic receptor.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Glioblastoma | [1] | |||
Sensitive Disease | Glioblastoma [ICD-11: 2A00.02] | |||
Sensitive Drug | Maraviroc | |||
Molecule Alteration | Function | Inhibition |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
Cell Pathway Regulation | CCL5-CCR5 signaling pathway | Inhibition | has05163 | |
In Vivo Model | Intracranial GBM patient-derived xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Neutral comet assay; ELISA assay; Immunofluorescence staining analysis; Immunohistochemistry staining analysi; Immunoblot assay | |||
Experiment for Drug Resistance |
CCK-8 assay | |||
Mechanism Description | The authors uncovered that pericytes potentiate DNA damage repair (DDR) in GBM cells residing in the perivascular niche, which induces temozolomide (TMZ) chemoresistance. Disrupting CCL5-CCR5 paracrine signaling through the brain-penetrable CCR5 antagonist maraviroc (MVC) potently inhibits pericyte-promoted DDR and effectively improves the chemotherapeutic efficacy of TMZ. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.