Molecule Information
General Information of the Molecule (ID: Mol01929)
| Name |
Transmembrane protein (TMEFF1)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
TMEFF1; C9orf2
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
TMEFF1
|
||||
| Gene ID | |||||
| Location |
chr9:100,473,149-100,577,636[+]
|
||||
| Sequence |
MGAAAAEAPLRLPAAPPLAFCCYTSVLLLFAFSLPGSRASNQPPGGGGGSGGDCPGGKGK
SINCSELNVRESDVRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSNGDTYQN ECFLRRAACKHQKEITVIARGPCYSDNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAECD EDAENVGCVCNIDCSGYSFNPVCASDGSSYNNPCFVREASCIKQEQIDIRHLGHCTDTDD TSLLGKKDDGLQYRPDVKDASDQREDVYIGNHMPCPENLNGYCIHGKCEFIYSTQKASCR CESGYTGQHCEKTDFSILYVVPSRQKLTHVLIAAIIGAVQIAIIVAIVMCITRKCPKNNR GRRQKQNLGHFTSDTSSRMV Click to Show/Hide
|
||||
| Function |
May inhibit NODAL and BMP signaling during neural patterning (By similarity). May be a tumor suppressor in brain cancers.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Ovarian cancer | [1] | |||
| Sensitive Disease | Ovarian cancer [ICD-11: 2C73.0] | |||
| Sensitive Drug | Butorphanol | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
| In Vitro Model | LN308 cells | Brain | Homo sapiens (Human) | CVCL_0394 |
| Primary pulmonary lymphoepithelioma-like carcinoma tissue | . | |||
| HCK1T cells | Ovary | Homo sapiens (Human) | N.A. | |
| Experiment for Molecule Alteration |
Western blotting analysis | |||
| Experiment for Drug Resistance |
CCK8 assay; Colony Formation assay; Transwell assay; Flow Cytometry | |||
| Mechanism Description | An important issue with compounds for treating ovarian cancer is the development of drug resistance and side effects. Butorphanol is a synthetic opioid. Opioids have been shown to promote or prevent tumor growth and metastasis. Butorphanol Inhibits the Malignant Biological Behaviors of Ovarian Cancer Cells via Down-Regulating the Expression of TMEFF1. | |||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
