General Information of the Molecule (ID: Mol01926)
Name
Paired box 8 (PAX8) ,Homo sapiens
Synonyms
PAX8
    Click to Show/Hide
Molecule Type
Protein
Gene Name
PAX8
Gene ID
7849
Location
chr2:113,215,997-113,278,921[-]
Sequence
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK
ILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDND
TVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPF
ERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAD
PHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQAL
LSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFP
NSSLLSSPYYYSSTSRPSAPPTTATAFDHL
    Click to Show/Hide
3D-structure
PDB ID
2K27
Classification
Transcription regulator
Method
Solution nmr
Resolution
No Resolution Dat Å
Function
Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells.
    Click to Show/Hide
Uniprot ID
PAX8_HUMAN
Ensembl ID
ENSG00000125618
HGNC ID
HGNC:8622
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Thyrotropin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Subclinical hypothyroidism [ICD-11: 5A00.22] [1]
Resistant Disease Subclinical hypothyroidism [ICD-11: 5A00.22]
Resistant Drug Thyrotropin
Molecule Alteration Missense mutation
p.L16P
Experimental Note Identified from the Human Clinical Data
Mechanism Description PAX8 mutations are not a relevant cause of sporadic thyroid ectopy or genuine agenesis but found in a minority of cases (e.g. 1/28 German, 1/16 Chinese) within the normotopic hypoplasia subgroup. More generally, heterozygous PAX8 LOF mutations have to be considered as another cause of RTSH that is clinically and by thyroid function tests indistinguishable from that caused by TSHR mutations. The clinical severity can thus range from subclinical hypothyroidism with normal-sized gland to overt hypothyroidism with severe thyroid gland hypoplasia.
Disease Class: Subclinical hypothyroidism [ICD-11: 5A00.22] [1]
Resistant Disease Subclinical hypothyroidism [ICD-11: 5A00.22]
Resistant Drug Thyrotropin
Molecule Alteration Missense mutation
p.F20S
Experimental Note Identified from the Human Clinical Data
Mechanism Description PAX8 mutations are not a relevant cause of sporadic thyroid ectopy or genuine agenesis but found in a minority of cases (e.g. 1/28 German, 1/16 Chinese) within the normotopic hypoplasia subgroup. More generally, heterozygous PAX8 LOF mutations have to be considered as another cause of RTSH that is clinically and by thyroid function tests indistinguishable from that caused by TSHR mutations. The clinical severity can thus range from subclinical hypothyroidism with normal-sized gland to overt hypothyroidism with severe thyroid gland hypoplasia.
Disease Class: Subclinical hypothyroidism [ICD-11: 5A00.22] [1]
Resistant Disease Subclinical hypothyroidism [ICD-11: 5A00.22]
Resistant Drug Thyrotropin
Molecule Alteration Missense mutation
p.R133Q
Experimental Note Identified from the Human Clinical Data
Mechanism Description PAX8 mutations are not a relevant cause of sporadic thyroid ectopy or genuine agenesis but found in a minority of cases (e.g. 1/28 German, 1/16 Chinese) within the normotopic hypoplasia subgroup. More generally, heterozygous PAX8 LOF mutations have to be considered as another cause of RTSH that is clinically and by thyroid function tests indistinguishable from that caused by TSHR mutations. The clinical severity can thus range from subclinical hypothyroidism with normal-sized gland to overt hypothyroidism with severe thyroid gland hypoplasia.
Disease Class: Congenital hypothyroidism [ICD-11: 5A00.0] [1]
Resistant Disease Congenital hypothyroidism [ICD-11: 5A00.0]
Resistant Drug Thyrotropin
Molecule Alteration Missense mutation
p.L16P
Experimental Note Identified from the Human Clinical Data
Mechanism Description PAX8 mutations are not a relevant cause of sporadic thyroid ectopy or genuine agenesis but found in a minority of cases (e.g. 1/28 German, 1/16 Chinese) within the normotopic hypoplasia subgroup. More generally, heterozygous PAX8 LOF mutations have to be considered as another cause of RTSH that is clinically and by thyroid function tests indistinguishable from that caused by TSHR mutations. The clinical severity can thus range from subclinical hypothyroidism with normal-sized gland to overt hypothyroidism with severe thyroid gland hypoplasia.
Disease Class: Congenital hypothyroidism [ICD-11: 5A00.0] [1]
Resistant Disease Congenital hypothyroidism [ICD-11: 5A00.0]
Resistant Drug Thyrotropin
Molecule Alteration Missense mutation
p.F20S
Experimental Note Identified from the Human Clinical Data
Mechanism Description PAX8 mutations are not a relevant cause of sporadic thyroid ectopy or genuine agenesis but found in a minority of cases (e.g. 1/28 German, 1/16 Chinese) within the normotopic hypoplasia subgroup. More generally, heterozygous PAX8 LOF mutations have to be considered as another cause of RTSH that is clinically and by thyroid function tests indistinguishable from that caused by TSHR mutations. The clinical severity can thus range from subclinical hypothyroidism with normal-sized gland to overt hypothyroidism with severe thyroid gland hypoplasia.
Disease Class: Congenital hypothyroidism [ICD-11: 5A00.0] [1]
Resistant Disease Congenital hypothyroidism [ICD-11: 5A00.0]
Resistant Drug Thyrotropin
Molecule Alteration Missense mutation
p.R133Q
Experimental Note Identified from the Human Clinical Data
Mechanism Description PAX8 mutations are not a relevant cause of sporadic thyroid ectopy or genuine agenesis but found in a minority of cases (e.g. 1/28 German, 1/16 Chinese) within the normotopic hypoplasia subgroup. More generally, heterozygous PAX8 LOF mutations have to be considered as another cause of RTSH that is clinically and by thyroid function tests indistinguishable from that caused by TSHR mutations. The clinical severity can thus range from subclinical hypothyroidism with normal-sized gland to overt hypothyroidism with severe thyroid gland hypoplasia.
References
Ref 1 Resistance to thyrotropin .Best Pract Res Clin Endocrinol Metab. 2017 Mar;31(2):183-194. doi: 10.1016/j.beem.2017.03.004. Epub 2017 Mar 30. 10.1016/j.beem.2017.03.004

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.