Molecule Information
General Information of the Molecule (ID: Mol01926)
| Name |
Paired box 8 (PAX8)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
PAX8
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
PAX8
|
||||
| Gene ID | |||||
| Location |
chr2:113,215,997-113,278,921[-]
|
||||
| Sequence |
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK
ILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDND TVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPF ERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAD PHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQAL LSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFP NSSLLSSPYYYSSTSRPSAPPTTATAFDHL Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Investigative Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Subclinical hypothyroidism [ICD-11: 5A00.22] | [1] | |||
| Resistant Disease | Subclinical hypothyroidism [ICD-11: 5A00.22] | |||
| Resistant Drug | Thyrotropin | |||
| Molecule Alteration | Missense mutation | p.L16P |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Mechanism Description | PAX8 mutations are not a relevant cause of sporadic thyroid ectopy or genuine agenesis but found in a minority of cases (e.g. 1/28 German, 1/16 Chinese) within the normotopic hypoplasia subgroup. More generally, heterozygous PAX8 LOF mutations have to be considered as another cause of RTSH that is clinically and by thyroid function tests indistinguishable from that caused by TSHR mutations. The clinical severity can thus range from subclinical hypothyroidism with normal-sized gland to overt hypothyroidism with severe thyroid gland hypoplasia. | |||
| Disease Class: Subclinical hypothyroidism [ICD-11: 5A00.22] | [1] | |||
| Resistant Disease | Subclinical hypothyroidism [ICD-11: 5A00.22] | |||
| Resistant Drug | Thyrotropin | |||
| Molecule Alteration | Missense mutation | p.F20S |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Mechanism Description | PAX8 mutations are not a relevant cause of sporadic thyroid ectopy or genuine agenesis but found in a minority of cases (e.g. 1/28 German, 1/16 Chinese) within the normotopic hypoplasia subgroup. More generally, heterozygous PAX8 LOF mutations have to be considered as another cause of RTSH that is clinically and by thyroid function tests indistinguishable from that caused by TSHR mutations. The clinical severity can thus range from subclinical hypothyroidism with normal-sized gland to overt hypothyroidism with severe thyroid gland hypoplasia. | |||
| Disease Class: Subclinical hypothyroidism [ICD-11: 5A00.22] | [1] | |||
| Resistant Disease | Subclinical hypothyroidism [ICD-11: 5A00.22] | |||
| Resistant Drug | Thyrotropin | |||
| Molecule Alteration | Missense mutation | p.R133Q |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Mechanism Description | PAX8 mutations are not a relevant cause of sporadic thyroid ectopy or genuine agenesis but found in a minority of cases (e.g. 1/28 German, 1/16 Chinese) within the normotopic hypoplasia subgroup. More generally, heterozygous PAX8 LOF mutations have to be considered as another cause of RTSH that is clinically and by thyroid function tests indistinguishable from that caused by TSHR mutations. The clinical severity can thus range from subclinical hypothyroidism with normal-sized gland to overt hypothyroidism with severe thyroid gland hypoplasia. | |||
| Disease Class: Congenital hypothyroidism [ICD-11: 5A00.0] | [1] | |||
| Resistant Disease | Congenital hypothyroidism [ICD-11: 5A00.0] | |||
| Resistant Drug | Thyrotropin | |||
| Molecule Alteration | Missense mutation | p.L16P |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Mechanism Description | PAX8 mutations are not a relevant cause of sporadic thyroid ectopy or genuine agenesis but found in a minority of cases (e.g. 1/28 German, 1/16 Chinese) within the normotopic hypoplasia subgroup. More generally, heterozygous PAX8 LOF mutations have to be considered as another cause of RTSH that is clinically and by thyroid function tests indistinguishable from that caused by TSHR mutations. The clinical severity can thus range from subclinical hypothyroidism with normal-sized gland to overt hypothyroidism with severe thyroid gland hypoplasia. | |||
| Disease Class: Congenital hypothyroidism [ICD-11: 5A00.0] | [1] | |||
| Resistant Disease | Congenital hypothyroidism [ICD-11: 5A00.0] | |||
| Resistant Drug | Thyrotropin | |||
| Molecule Alteration | Missense mutation | p.F20S |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Mechanism Description | PAX8 mutations are not a relevant cause of sporadic thyroid ectopy or genuine agenesis but found in a minority of cases (e.g. 1/28 German, 1/16 Chinese) within the normotopic hypoplasia subgroup. More generally, heterozygous PAX8 LOF mutations have to be considered as another cause of RTSH that is clinically and by thyroid function tests indistinguishable from that caused by TSHR mutations. The clinical severity can thus range from subclinical hypothyroidism with normal-sized gland to overt hypothyroidism with severe thyroid gland hypoplasia. | |||
| Disease Class: Congenital hypothyroidism [ICD-11: 5A00.0] | [1] | |||
| Resistant Disease | Congenital hypothyroidism [ICD-11: 5A00.0] | |||
| Resistant Drug | Thyrotropin | |||
| Molecule Alteration | Missense mutation | p.R133Q |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Mechanism Description | PAX8 mutations are not a relevant cause of sporadic thyroid ectopy or genuine agenesis but found in a minority of cases (e.g. 1/28 German, 1/16 Chinese) within the normotopic hypoplasia subgroup. More generally, heterozygous PAX8 LOF mutations have to be considered as another cause of RTSH that is clinically and by thyroid function tests indistinguishable from that caused by TSHR mutations. The clinical severity can thus range from subclinical hypothyroidism with normal-sized gland to overt hypothyroidism with severe thyroid gland hypoplasia. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
