Molecule Information
General Information of the Molecule (ID: Mol01924)
| Name |
Wnt family member 7B (WNT7B)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
WNT7B
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
WNT7B
|
||||
| Gene ID | |||||
| Location |
chr22:45,920,366-45,977,162[-]
|
||||
| Sequence |
MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAII
VIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVT AACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLM NLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEV VRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPG ADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK Click to Show/Hide
|
||||
| Function |
Ligand for members of the frizzled family of seven transmembrane receptors that functions in the canonical Wnt/beta-catenin signaling pathway. Required for normal fusion of the chorion and the allantois during placenta development. Required for central nervous system (CNS) angiogenesis and blood-brain barrier regulation.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Anaplastic thyroid cancer [ICD-11: 2D10.2] | [1] | |||
| Sensitive Disease | Anaplastic thyroid cancer [ICD-11: 2D10.2] | |||
| Sensitive Drug | Pyrvinium | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Thyroid cancer [ICD-11: 2D10] | |||
| The Specified Disease | Thyroid cancer | |||
| The Studied Tissue | Thyroid | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.23E-19 Fold-change: 7.54E-02 Z-score: 9.46E+00 |
|||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Wnt signaling pathway | Activation | hsa04310 | |
| In Vitro Model | LNCaP cells | Prostate | Homo sapiens (Human) | CVCL_0395 |
| HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |
| Experiment for Molecule Alteration |
Western blot analysis; ART sensitivity assay | |||
| Experiment for Drug Resistance |
CCK-8 cell proliferation assay; Flow cytometry | |||
| Mechanism Description | Pyrvinium pamoate can overcome artemisinin's resistance in anaplastic thyroid cancer. The resistance of CAL-62 to ART was related to the upregulation of the WNT signaling pathway. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Thyroid | |
| The Specified Disease | Thyroid cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.23E-19; Fold-change: 2.39E-01; Z-score: 1.20E+00 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.92E-09; Fold-change: 1.70E-01; Z-score: 9.07E-01 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
