General Information of the Molecule (ID: Mol01912)
Name
RELB proto-oncogene, NF-kB subunit (RELB) ,Homo sapiens
Synonyms
RELB
    Click to Show/Hide
Molecule Type
Protein
Gene Name
RELB
Gene ID
5971
Location
chr19:45,001,449-45,038,198[+]
Sequence
MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEY
IKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPG
PGPQPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEV
TACLVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIE
RKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNT
SELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVHRQIAIV
FKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLG
ELNSSDPHGIESKRRKKKPAILDHFLPNHGSGPFLPPSALLPDPDFFSGTVSLPGLEPPG
GPDLLDDGFAYDPTAPTLFTMLDLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQ
APGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT
    Click to Show/Hide
3D-structure
PDB ID
8G8R
Classification
Transcription
Method
X-ray diffraction
Resolution
2.60  Å
Function
NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. NF-kappa-B heterodimeric RelB-p50 and RelB-p52 complexes are transcriptional activators. RELB neither associates with DNA nor with RELA/p65 or REL. Stimulates promoter activity in the presence of NFKB2/p49. As a member of the NUPR1/RELB/IER3 survival pathway, may provide pancreatic ductal adenocarcinoma with remarkable resistance to cell stress, such as starvation or gemcitabine treatment. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer in a CRY1/CRY2 independent manner. Increased repression of the heterodimer is seen in the presence of NFKB2/p52. Is required for both T and B lymphocyte maturation and function.
    Click to Show/Hide
Uniprot ID
RELB_HUMAN
Ensembl ID
ENSG00000104856
HGNC ID
HGNC:9956
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Everolimus
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0] [1]
Resistant Disease Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
Resistant Drug Everolimus
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation NF-kB signaling pathway Activation hsa04218
In Vitro Model QGP-1R cells carcinoid Homo sapiens (Human) N.A.
Experiment for
Molecule Alteration
RT-PCR
Experiment for
Drug Resistance
Cell viability assay; Colony formation assay
Mechanism Description The activation of the STAT3 pathway induced by TNF is mediated by NF-kB p65. NF-kB p65 and STAT3 inhibitors decrease QGP-1 viability, spheroids growth, and Pa-NETs cell proliferation. These effects are maintained in everolimus-resistant QGP-1R cells.
Disease Class: Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0] [1]
Resistant Disease Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
Resistant Drug Everolimus
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation NF-kB signaling pathway Activation hsa04218
In Vitro Model QGP-1R cells carcinoid Homo sapiens (Human) N.A.
Experiment for
Molecule Alteration
Western blot assay
Experiment for
Drug Resistance
Cell viability assay; Colony formation assay
Mechanism Description The activation of the STAT3 pathway induced by TNF is mediated by NF-kB p65. NF-kB p65 and STAT3 inhibitors decrease QGP-1 viability, spheroids growth, and Pa-NETs cell proliferation. These effects are maintained in everolimus-resistant QGP-1R cells.
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
PLX51107
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Uveal melanoma [ICD-11: 2D0Y.0] [2]
Sensitive Disease Uveal melanoma [ICD-11: 2D0Y.0]
Sensitive Drug PLX51107
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation NF-kappaB signaling pathway Inhibition hsa04064
In Vitro Model Omm1.3 cells Skin Homo sapiens (Human) N.A.
92.1 cells Peripheral blood Homo sapiens (Human) N.A.
UM004 cells Skin Homo sapiens (Human) N.A.
Omm1 cells Kidney Homo sapiens (Human) CVCL_6939
In Vivo Model Athymic nu/nu mouse xenograft model Mus musculus
Experiment for
Molecule Alteration
qRT-PCR; Western blotting assay
Experiment for
Drug Resistance
CCK8 assay
Mechanism Description Both assays showed higher expression of these genes(REL, RELB, CEBPD, SOD2) at the mRNA and protein level in the resistant cells compared with their parental counterpart. Furthermore, NF-kappa-B activity was increased in the resistant cells compared with parental, and it could be inhibited by PTL.Inhibition of NF-kappa-B-dependent signaling enhances sensitivity and overcomes resistance to BET inhibition in uveal melanoma.
References
Ref 1 Pancreatic neuroendocrine tumor progression and resistance to everolimus: the crucial role of NF-kB and STAT3 interplay. J Endocrinol Invest. 2024 May;47(5):1101-1117.
Ref 2 Inhibition of NF-kB-Dependent Signaling Enhances Sensitivity and Overcomes Resistance to BET Inhibition in Uveal Melanoma .Cancer Res. 2019 May 1;79(9):2415-2425. doi: 10.1158/0008-5472.CAN-18-3177. Epub 2019 Mar 18. 10.1158/0008-5472.CAN-18-3177

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.