General Information of the Molecule (ID: Mol01890)
Name
L1 cell adhesion molecule (L1CAM) ,Homo sapiens
Synonyms
L1CAM; CAML1; MIC5
    Click to Show/Hide
Molecule Type
Protein
Gene Name
L1CAM
Gene ID
3897
Location
chrX:153,861,514-153,886,173[-]
Sequence
MVVALRYVWPLLLCSPCLLIQIPEEYEGHHVMEPPVITEQSPRRLVVFPTDDISLKCEAS
GKPEVQFRWTRDGVHFKPKEELGVTVYQSPHSGSFTITGNNSNFAQRFQGIYRCFASNKL
GTAMSHEIRLMAEGAPKWPKETVKPVEVEEGESVVLPCNPPPSAEPLRIYWMNSKILHIK
QDERVTMGQNGNLYFANVLTSDNHSDYICHAHFPGTRTIIQKEPIDLRVKATNSMIDRKP
RLLFPTNSSSHLVALQGQPLVLECIAEGFPTPTIKWLRPSGPMPADRVTYQNHNKTLQLL
KVGEEDDGEYRCLAENSLGSARHAYYVTVEAAPYWLHKPQSHLYGPGETARLDCQVQGRP
QPEVTWRINGIPVEELAKDQKYRIQRGALILSNVQPSDTMVTQCEARNRHGLLLANAYIY
VVQLPAKILTADNQTYMAVQGSTAYLLCKAFGAPVPSVQWLDEDGTTVLQDERFFPYANG
TLGIRDLQANDTGRYFCLAANDQNNVTIMANLKVKDATQITQGPRSTIEKKGSRVTFTCQ
ASFDPSLQPSITWRGDGRDLQELGDSDKYFIEDGRLVIHSLDYSDQGNYSCVASTELDVV
ESRAQLLVVGSPGPVPRLVLSDLHLLTQSQVRVSWSPAEDHNAPIEKYDIEFEDKEMAPE
KWYSLGKVPGNQTSTTLKLSPYVHYTFRVTAINKYGPGEPSPVSETVVTPEAAPEKNPVD
VKGEGNETTNMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPWQEQIVSDPFLVVSNTST
FVPYEIKVQAVNSQGKGPEPQVTIGYSGEDYPQAIPELEGIEILNSSAVLVKWRPVDLAQ
VKGHLRGYNVTYWREGSQRKHSKRHIHKDHVVVPANTTSVILSGLRPYSSYHLEVQAFNG
RGSGPASEFTFSTPEGVPGHPEALHLECQSNTSLLLRWQPPLSHNGVLTGYVLSYHPLDE
GGKGQLSFNLRDPELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDF
GNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDL
QPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATEGWFIGFVSAIILLLLVLLIL
CFIKRSKGGKYSVKDKEDTQVDSEARPMKDETFGEYRSLESDNEEKAFGSSQPSLNGDIK
PLGSDDSLADYGGSVDVQFNEDGSFIGQYSGKKEKEAAGGNDSSGATSPINPAVALE
    Click to Show/Hide
3D-structure
PDB ID
8AFO
Classification
Cell adhesion
Method
X-ray diffraction
Resolution
1.99  Å
Function
Neural cell adhesion molecule involved in the dynamics of cell adhesion and in the generation of transmembrane signals at tyrosine kinase receptors. During brain development, critical in multiple processes, including neuronal migration, axonal growth and fasciculation, and synaptogenesis. In the mature brain, plays a role in the dynamics of neuronal structure and function, including synaptic plasticity.
    Click to Show/Hide
Uniprot ID
L1CAM_HUMAN
Ensembl ID
ENSG00000198910
HGNC ID
HGNC:6470
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  RTDM: Regulation by the Disease Microenvironment
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Anagrelide
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Regulation by the Disease Microenvironment (RTDM) Click to Show/Hide
Disease Class: Ovarian cancer [ICD-11: 2C73.0] [1]
Resistant Disease Ovarian cancer [ICD-11: 2C73.0]
Resistant Drug Anagrelide
Molecule Alteration Expression
Down-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Ovarian cancer [ICD-11: 2C73]
The Specified Disease Ovarian cancer
The Studied Tissue Blood
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 2.31E-10
Fold-change: -2.89E-01
Z-score: -6.73E+00
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell migration Activation hsa04670
In Vitro Model 22RV1 cells Prostate Homo sapiens (Human) CVCL_1045
Experiment for
Molecule Alteration
Puromycin selection and monitored regularly for the maintenance of L1 silencing assay
Experiment for
Drug Resistance
Migration assay
Mechanism Description With OVCAR3 cells treated with anagrelide, 2-hydroxy-5-fluoropyrimidine and mestranol , the gap width closure was seen from 48 h onward at all concentrations tested. Similar results were obtained with U251 cells, and L1's metastatic potential is further evidenced by its promotion of epithelial-mesenchymal transition, endothelial cell transcytosis and resistance to chemo- and radiotherapy.
Disease Class: Glioblastoma [ICD-11: 2A00.02] [1]
Resistant Disease Glioblastoma [ICD-11: 2A00.02]
Resistant Drug Anagrelide
Molecule Alteration Expression
Down-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Brain cancer [ICD-11: 2A00]
The Specified Disease Brain cancer
The Studied Tissue Nervous tissue
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 5.83E-128
Fold-change: -2.68E-01
Z-score: -2.75E+01
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell migration Activation hsa04670
In Vitro Model MDCK cells Kidney Canis lupus familiaris (Dog) (Canis familiaris) CVCL_0422
Experiment for
Molecule Alteration
Puromycin selection and monitored regularly for the maintenance of L1 silencing assay
Experiment for
Drug Resistance
Migration assay
Mechanism Description With OVCAR3 cells treated with anagrelide, 2-hydroxy-5-fluoropyrimidine and mestranol , the gap width closure was seen from 48 h onward at all concentrations tested. Similar results were obtained with U251 cells, and L1's metastatic potential is further evidenced by its promotion of epithelial-mesenchymal transition, endothelial cell transcytosis and resistance to chemo- and radiotherapy.
Mestranol
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Regulation by the Disease Microenvironment (RTDM) Click to Show/Hide
Disease Class: Ovarian cancer [ICD-11: 2C73.0] [1]
Resistant Disease Ovarian cancer [ICD-11: 2C73.0]
Resistant Drug Mestranol
Molecule Alteration Expression
Down-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Ovarian cancer [ICD-11: 2C73]
The Specified Disease Ovarian cancer
The Studied Tissue Blood
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 2.31E-10
Fold-change: -2.89E-01
Z-score: -6.73E+00
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell migration Activation hsa04670
In Vitro Model 22RV1 cells Prostate Homo sapiens (Human) CVCL_1045
Experiment for
Molecule Alteration
Puromycin selection and monitored regularly for the maintenance of L1 silencing assay
Experiment for
Drug Resistance
Migration assay
Mechanism Description With OVCAR3 cells treated with anagrelide, 2-hydroxy-5-fluoropyrimidine and mestranol , the gap width closure was seen from 48 h onward at all concentrations tested. Similar results were obtained with U251 cells, and L1's metastatic potential is further evidenced by its promotion of epithelial-mesenchymal transition, endothelial cell transcytosis and resistance to chemo- and radiotherapy.
Disease Class: Glioblastoma [ICD-11: 2A00.02] [1]
Resistant Disease Glioblastoma [ICD-11: 2A00.02]
Resistant Drug Mestranol
Molecule Alteration Expression
Down-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Brain cancer [ICD-11: 2A00]
The Specified Disease Glioblastoma
The Studied Tissue Nervous tissue
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 5.40E-46
Fold-change: -3.38E+00
Z-score: -3.41E+01
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell migration Activation hsa04670
In Vitro Model MDCK cells Kidney Canis lupus familiaris (Dog) (Canis familiaris) CVCL_0422
Experiment for
Molecule Alteration
Puromycin selection and monitored regularly for the maintenance of L1 silencing assay
Experiment for
Drug Resistance
Migration assay
Mechanism Description With OVCAR3 cells treated with anagrelide, 2-hydroxy-5-fluoropyrimidine and mestranol , the gap width closure was seen from 48 h onward at all concentrations tested. Similar results were obtained with U251 cells, and L1's metastatic potential is further evidenced by its promotion of epithelial-mesenchymal transition, endothelial cell transcytosis and resistance to chemo- and radiotherapy.
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
2-hydroxy-5-fluoropyrimidine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Regulation by the Disease Microenvironment (RTDM) Click to Show/Hide
Disease Class: Ovarian cancer [ICD-11: 2C73.0] [1]
Resistant Disease Ovarian cancer [ICD-11: 2C73.0]
Resistant Drug 2-hydroxy-5-fluoropyrimidine
Molecule Alteration Expression
Down-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Ovarian cancer [ICD-11: 2C73]
The Specified Disease Ovarian cancer
The Studied Tissue Blood
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 2.31E-10
Fold-change: -2.89E-01
Z-score: -6.73E+00
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell migration Activation hsa04670
In Vitro Model 22RV1 cells Prostate Homo sapiens (Human) CVCL_1045
Experiment for
Molecule Alteration
Puromycin selection and monitored regularly for the maintenance of L1 silencing assay
Experiment for
Drug Resistance
Migration assay
Mechanism Description With OVCAR3 cells treated with anagrelide, 2-hydroxy-5-fluoropyrimidine and mestranol , the gap width closure was seen from 48 h onward at all concentrations tested. Similar results were obtained with U251 cells, and L1's metastatic potential is further evidenced by its promotion of epithelial-mesenchymal transition, endothelial cell transcytosis and resistance to chemo- and radiotherapy.
Disease Class: Glioblastoma [ICD-11: 2A00.02] [1]
Resistant Disease Glioblastoma [ICD-11: 2A00.02]
Resistant Drug 2-hydroxy-5-fluoropyrimidine
Molecule Alteration Expression
Down-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Brain cancer [ICD-11: 2A00]
The Specified Disease Glioblastoma
The Studied Tissue Nervous tissue
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 5.40E-46
Fold-change: -3.38E+00
Z-score: -3.41E+01
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell migration Activation hsa04670
In Vitro Model MDCK cells Kidney Canis lupus familiaris (Dog) (Canis familiaris) CVCL_0422
Experiment for
Molecule Alteration
Puromycin selection and monitored regularly for the maintenance of L1 silencing assay
Experiment for
Drug Resistance
Migration assay
Mechanism Description With OVCAR3 cells treated with anagrelide, 2-hydroxy-5-fluoropyrimidine and mestranol , the gap width closure was seen from 48 h onward at all concentrations tested. Similar results were obtained with U251 cells, and L1's metastatic potential is further evidenced by its promotion of epithelial-mesenchymal transition, endothelial cell transcytosis and resistance to chemo- and radiotherapy.
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Click to Show/Hide the Resistance Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Nervous tissue
The Specified Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.83E-128; Fold-change: -1.78E+00; Z-score: -2.43E+00
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem tissue
The Specified Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.79E-01; Fold-change: -5.20E-01; Z-score: -1.16E+00
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specified Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.74E-03; Fold-change: 2.38E-01; Z-score: 9.47E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem tissue
The Specified Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.88E-01; Fold-change: 3.88E-01; Z-score: 9.57E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Ovary
The Specified Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.13E-08; Fold-change: 7.92E-01; Z-score: 3.74E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.12E-06; Fold-change: 7.54E-01; Z-score: 1.76E+00
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 Antagonistic L1 Adhesion Molecule Mimetic Compounds Inhibit Glioblastoma Cell Migration In Vitro .Biomolecules. 2022 Mar 12;12(3):439. doi: 10.3390/biom12030439. 10.3390/biom12030439

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.