Molecule Information
General Information of the Molecule (ID: Mol01883)
| Name |
Interleukin 2 receptor subunit alpha (IL2RA)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
IL2RA
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
IL2RA
|
||||
| Gene ID | |||||
| Location |
chr10:6,010,689-6,062,370[-]
|
||||
| Sequence |
MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQ VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Head and neck squamous cell carcinoma [ICD-11: 2D42.1] | [1] | |||
| Resistant Disease | Head and neck squamous cell carcinoma [ICD-11: 2D42.1] | |||
| Resistant Drug | Paclitaxel | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Head and neck cancer [ICD-11: 2D42] | |||
| The Specified Disease | Head and neck cancer | |||
| The Studied Tissue | Head and neck tissue | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.41E-27 Fold-change: 2.21E-01 Z-score: 1.24E+01 |
|||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | PCI-13 cells | Ovary | Homo sapiens (Human) | CVCL_C182 |
| Experiment for Molecule Alteration |
Western blotting assay | |||
| Experiment for Drug Resistance |
MTT assay | |||
| Mechanism Description | IL-2Ralpha-expressing cells were significantly more resistant to apoptosis induction by a tripeptidyl proteasome inhibitor (ALLN) and two chemotherapeutic drugs (VP-16 and taxol) than the control or IL-2Rgamma+ cells.IL-2Ralpha overexpression increases cell proliferation rate associated with increasing levels of cell cycle regulatory proteins. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Head and neck squamous cell carcinoma [ICD-11: 2D42.1] | [1] | |||
| Resistant Disease | Head and neck squamous cell carcinoma [ICD-11: 2D42.1] | |||
| Resistant Drug | Etoposide | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | PCI-13 cells | Ovary | Homo sapiens (Human) | CVCL_C182 |
| Experiment for Molecule Alteration |
Western blotting assay | |||
| Experiment for Drug Resistance |
MTT assay | |||
| Mechanism Description | IL-2Ralpha-expressing cells were significantly more resistant to apoptosis induction by a tripeptidyl proteasome inhibitor (ALLN) and two chemotherapeutic drugs (VP-16 and taxol) than the control or IL-2Rgamma+ cells.IL-2Ralpha overexpression increases cell proliferation rate associated with increasing levels of cell cycle regulatory proteins. | |||
Investigative Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Head and neck squamous cell carcinoma [ICD-11: 2D42.1] | [1] | |||
| Resistant Disease | Head and neck squamous cell carcinoma [ICD-11: 2D42.1] | |||
| Resistant Drug | D-Allosamine | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | PCI-13 cells | Ovary | Homo sapiens (Human) | CVCL_C182 |
| Experiment for Molecule Alteration |
Western blotting assay | |||
| Experiment for Drug Resistance |
MTT assay | |||
| Mechanism Description | IL-2Ralpha-expressing cells were significantly more resistant to apoptosis induction by a tripeptidyl proteasome inhibitor (ALLN) and two chemotherapeutic drugs (VP-16 and taxol) than the control or IL-2Rgamma+ cells.IL-2Ralpha overexpression increases cell proliferation rate associated with increasing levels of cell cycle regulatory proteins. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
