Molecule Information
General Information of the Molecule (ID: Mol01883)
Name |
Interleukin 2 receptor subunit alpha (IL2RA)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
IL2RA
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
IL2RA
|
||||
Gene ID | |||||
Location |
chr10:6,010,689-6,062,370[-]
|
||||
Sequence |
MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQ VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI Click to Show/Hide
|
||||
Function |
Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Head and neck squamous cell carcinoma | [1] | |||
Resistant Disease | Head and neck squamous cell carcinoma [ICD-11: 2D42.1] | |||
Resistant Drug | Etoposide | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | PCI-13 cells | Ovary | Homo sapiens (Human) | CVCL_C182 |
Experiment for Molecule Alteration |
Western blotting assay | |||
Experiment for Drug Resistance |
MTT assay | |||
Mechanism Description | IL-2Ralpha-expressing cells were significantly more resistant to apoptosis induction by a tripeptidyl proteasome inhibitor (ALLN) and two chemotherapeutic drugs (VP-16 and taxol) than the control or IL-2Rgamma+ cells.IL-2Ralpha overexpression increases cell proliferation rate associated with increasing levels of cell cycle regulatory proteins. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Head and neck squamous cell carcinoma | [1] | |||
Resistant Disease | Head and neck squamous cell carcinoma [ICD-11: 2D42.1] | |||
Resistant Drug | Paclitaxel | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | PCI-13 cells | Ovary | Homo sapiens (Human) | CVCL_C182 |
Experiment for Molecule Alteration |
Western blotting assay | |||
Experiment for Drug Resistance |
MTT assay | |||
Mechanism Description | IL-2Ralpha-expressing cells were significantly more resistant to apoptosis induction by a tripeptidyl proteasome inhibitor (ALLN) and two chemotherapeutic drugs (VP-16 and taxol) than the control or IL-2Rgamma+ cells.IL-2Ralpha overexpression increases cell proliferation rate associated with increasing levels of cell cycle regulatory proteins. |
Investigative Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Head and neck squamous cell carcinoma | [1] | |||
Resistant Disease | Head and neck squamous cell carcinoma [ICD-11: 2D42.1] | |||
Resistant Drug | D-Allosamine | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | PCI-13 cells | Ovary | Homo sapiens (Human) | CVCL_C182 |
Experiment for Molecule Alteration |
Western blotting assay | |||
Experiment for Drug Resistance |
MTT assay | |||
Mechanism Description | IL-2Ralpha-expressing cells were significantly more resistant to apoptosis induction by a tripeptidyl proteasome inhibitor (ALLN) and two chemotherapeutic drugs (VP-16 and taxol) than the control or IL-2Rgamma+ cells.IL-2Ralpha overexpression increases cell proliferation rate associated with increasing levels of cell cycle regulatory proteins. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.