Molecule Information
General Information of the Molecule (ID: Mol01868)
Name |
Dopamine receptor D2 (DRD2)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
DRD2
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
DRD2
|
||||
Gene ID | |||||
Location |
chr11:113,409,605-113,475,691[-]
|
||||
Sequence |
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA VNPIIYTTFNIEFRKAFLKILHC Click to Show/Hide
|
||||
Function |
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Positively regulates postnatal regression of retinal hyaloid vessels via suppression of VEGFR2/KDR activity, downstream of OPN5.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Prolactin-secreting adenoma | [1] | |||
Resistant Disease | Prolactin-secreting adenoma [ICD-11: 2F37.Y] | |||
Resistant Drug | Bromocriptine | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Mechanism Description | Generally, the effectiveness of BRC or CAB has been related to a decreased expression in DRs, as the expression of such receptors has been shown to correlate with responsiveness to therapy in lactotroph, somatotroph, corticotroph and in clinically nonfunctioning PitNET. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Prolactin-secreting adenoma | [1] | |||
Resistant Disease | Prolactin-secreting adenoma [ICD-11: 2F37.Y] | |||
Resistant Drug | Cabergoline | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Mechanism Description | Generally, the effectiveness of BRC or CAB has been related to a decreased expression in DRs, as the expression of such receptors has been shown to correlate with responsiveness to therapy in lactotroph, somatotroph, corticotroph and in clinically nonfunctioning PitNET. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Pituitary | |
The Specified Disease | Pituitary cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 8.48E-01; Fold-change: -9.88E-02; Z-score: -2.18E-01 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Pituitary | |
The Specified Disease | Pituitary gonadotrope tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.35E-01; Fold-change: -4.00E-01; Z-score: -8.01E-01 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
![]() |
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.