Molecule Information
General Information of the Molecule (ID: Mol01861)
| Name |
Cytochrome P450 family 2 subfamily C member 9 (CYP2C9)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
CYP2C9; CYP2C10
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
CYP2C9
|
||||
| Gene ID | |||||
| Location |
chr10:94,938,658-94,990,091[+]
|
||||
| Sequence |
MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKV
YGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKW KEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS IIFHKRFDYKDQQFLNLMEKLNENIKILSSPWIQICNNFSPIIDYFPGTHNKLLKNVAFM KSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHNQPSEFTIESLENTAVDLFGAGTE TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYID LLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFK KSKYFMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVP PFYQLCFIPV Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
A cytochrome P450 monooxygenase involved in the metabolism of various endogenous substrates, including fatty acids and steroids. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the epoxidation of double bonds of polyunsaturated fatty acids (PUFA). Catalyzes the hydroxylation of carbon-hydrogen bonds. Metabolizes cholesterol toward 25-hydroxycholesterol, a physiological regulator of cellular cholesterol homeostasis. Exhibits low catalytic activity for the formation of catechol estrogens from 17beta-estradiol (E2) and estrone (E1), namely 2-hydroxy E1 and E2. Catalyzes bisallylic hydroxylation and hydroxylation with double-bond migration of polyunsaturated fatty acids (PUFA). Also metabolizes plant monoterpenes such as limonene. Oxygenates (R)- and (S)-limonene to produce carveol and perillyl alcohol. Contributes to the wide pharmacokinetics variability of the metabolism of drugs such as S-warfarin, diclofenac, phenytoin, tolbutamide and losartan.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Dysmenorrhea [ICD-11: GA34.3] | [1] | |||
| Resistant Disease | Dysmenorrhea [ICD-11: GA34.3] | |||
| Resistant Drug | Celecoxib | |||
| Molecule Alteration | SNP | CYP2C9*2/*2 |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Mechanism Description | For example, the CYP2C9*2/*2 polymorphism was associated with increased total clearance of celecoxib and diclofenac.48 More research is necessary to determine if other gain-of-function variants exist and alter NSAID metabolism. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Hypo-attenuated leaflet thickening [ICD-11: BD10.2] | [2] | |||
| Resistant Disease | Hypo-attenuated leaflet thickening [ICD-11: BD10.2] | |||
| Resistant Drug | Clopidogrel | |||
| Molecule Alteration | SNP | rs1799853+rs1057910 |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Mechanism Description | We thoroughly genotyped 34 SNPs and 8 SNPs that have been reported for clopidogrel and aspirin resistance. A total of 148 patients were enrolled. There were 15 patients demonstrating signs of HALT. Patients with HALT had a higher rate of atrial fibrillation (AF) pre-TAVR (33.3 vs. 7.5%, P = 0.01). | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Dysmenorrhea [ICD-11: GA34.3] | [1] | |||
| Resistant Disease | Dysmenorrhea [ICD-11: GA34.3] | |||
| Resistant Drug | Diclofenac | |||
| Molecule Alteration | SNP | CYP2C9*2/*2 |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Mechanism Description | For example, the CYP2C9*2/*2 polymorphism was associated with increased total clearance of celecoxib and diclofenac.48 More research is necessary to determine if other gain-of-function variants exist and alter NSAID metabolism. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
