Molecule Information

General Information of the Molecule (ID: Mol01848)

Name	Protein farnesyltransferase subunit beta (FNTB) ,Homo sapiens
Synonyms	Protein farnesyltransferase subunit beta; FTase-beta; CAAX farnesyltransferase subunit beta; Ras proteins prenyltransferase subunit beta; FNTB Click to Show/Hide
Molecule Type	Protein
Gene Name	FNTB
Gene ID	2342
Location	chr14:64,986,895-65,062,652[+]
Sequence	MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFS SYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQ IVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYDIINREKLLQY LYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCY SFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDF YHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPVYNIGPDKVIQATTYFLQKPV PGFEELKDETSAEPATD Click to Show/Hide
Function	Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. Click to Show/Hide
Uniprot ID	FNTB_HUMAN
Ensembl ID	ENSG00000257365
HGNC ID	HGNC:3785
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Lonafarnib

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Ovarian cancer			[1]
Resistant Disease	Ovarian cancer [ICD-11: 2C73.0]		Disease Info
Resistant Drug	Lonafarnib		Drug Info
Molecule Alteration	Noncoding	(c.7-17904G>C)
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Ovary		.
Experiment for Molecule Alteration	Western blotting analysis
Experiment for Drug Resistance	electrophoretic-mobility-shift assay; luciferase-reporter assay; RT-qPCR

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Click to Show/Hide the Resistance Disease of This Class

Ovarian cancer [ICD-11: 2C73]

Click to Show/Hide

Differential expression of molecule in resistant diseases
The Studied Tissue	Ovary
The Specified Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.00E-01; Fold-change: 1.47E-01; Z-score: 1.84E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.21E-01; Fold-change: 1.92E-01; Z-score: 1.79E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances		Click to View the Clearer Original Diagram
Download Molecule expression barchart for all samples Download Molecule expression data of patients in the normal section of the tissue adjacent to the disease section Download Molecule expression data of patients in the disease section of the tissue Download Molecule expression data in the tissue of healthy individual

References

Ref 1	The FNTB promoter polymorphism rs11623866 as a potential predictive biomarker for lonafarnib treatment of ovarian cancer patientsBr J Clin Pharmacol. 2015 Nov;80(5):1139-48. doi: 10.1111/bcp.12688. Epub 2015 Jul 22.