Molecule Information
General Information of the Molecule (ID: Mol01848)
| Name |
Protein farnesyltransferase subunit beta (FNTB)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Protein farnesyltransferase subunit beta; FTase-beta; CAAX farnesyltransferase subunit beta; Ras proteins prenyltransferase subunit beta; FNTB
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
FNTB
|
||||
| Gene ID | |||||
| Location |
chr14:64,986,895-65,062,652[+]
|
||||
| Sequence |
MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFS
SYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQ IVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYDIINREKLLQY LYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCY SFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDF YHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPVYNIGPDKVIQATTYFLQKPV PGFEELKDETSAEPATD Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Ovarian cancer [ICD-11: 2C73.0] | [1] | |||
| Resistant Disease | Ovarian cancer [ICD-11: 2C73.0] | |||
| Resistant Drug | Lonafarnib | |||
| Molecule Alteration | Noncoding | (c.7-17904G>C) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Ovary | N.A. | ||
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
electrophoretic-mobility-shift assay; luciferase-reporter assay; RT-qPCR | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Ovary | |
| The Specified Disease | Ovarian cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.00E-01; Fold-change: 1.47E-01; Z-score: 1.84E-01 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.21E-01; Fold-change: 1.92E-01; Z-score: 1.79E-01 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
