Molecule Information
General Information of the Molecule (ID: Mol01848)
Name |
Protein farnesyltransferase subunit beta (FNTB)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Protein farnesyltransferase subunit beta; FTase-beta; CAAX farnesyltransferase subunit beta; Ras proteins prenyltransferase subunit beta; FNTB
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
FNTB
|
||||
Gene ID | |||||
Location |
chr14:64,986,895-65,062,652[+]
|
||||
Sequence |
MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFS
SYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQ IVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYDIINREKLLQY LYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCY SFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDF YHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPVYNIGPDKVIQATTYFLQKPV PGFEELKDETSAEPATD Click to Show/Hide
|
||||
Function |
Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Ovarian cancer | [1] | |||
Resistant Disease | Ovarian cancer [ICD-11: 2C73.0] | |||
Resistant Drug | Lonafarnib | |||
Molecule Alteration | Noncoding | (c.7-17904G>C) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Ovary | . | ||
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
electrophoretic-mobility-shift assay; luciferase-reporter assay; RT-qPCR |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Ovary | |
The Specified Disease | Ovarian cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.00E-01; Fold-change: 1.47E-01; Z-score: 1.84E-01 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.21E-01; Fold-change: 1.92E-01; Z-score: 1.79E-01 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.