General Information of the Molecule (ID: Mol01837)
Name
Fibroblast growth factor receptor 4 (FGFR4) ,Homo sapiens
Synonyms
Fibroblast growth factor receptor 4; FGFR-4; CD antigen CD334; JTK2; TKF
    Click to Show/Hide
Molecule Type
Protein
Gene Name
FGFR4
Gene ID
2264
Location
chr5:177,086,905-177,098,144[+]
Sequence
MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRA
ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDS
LTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP
TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD
VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTA
AAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL
ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ
VVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVC
TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM
QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEA
LFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYG
LMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDS
VFSHDPLPLGSSSFPFGSGVQT
    Click to Show/Hide
Function
Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays a role in the regulation of cell proliferation, differentiation and migration, and in regulation of lipid metabolism, bile acid biosynthesis, glucose uptake, vitamin D metabolism and phosphate homeostasis. Required for normal down-regulation of the expression of CYP7A1, the rate-limiting enzyme in bile acid synthesis, in response to FGF19. Phosphorylates PLCG1 and FRS2. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Promotes SRC-dependent phosphorylation of the matrix protease MMP14 and its lysosomal degradation. FGFR4 signaling is down-regulated by receptor internalization and degradation; MMP14 promotes internalization and degradation of FGFR4. Mutations that lead to constitutive kinase activation or impair normal FGFR4 inactivation lead to aberrant signaling.
    Click to Show/Hide
Uniprot ID
FGFR4_HUMAN
Ensembl ID
ENSG00000160867
HGNC ID
HGNC:3691
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Erdafitinib
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Breast cancer [1]
Resistant Disease Breast cancer [ICD-11: 2C60.3]
Resistant Drug Erdafitinib
Molecule Alteration Missense mutation
p.V550M
Experimental Note Identified from the Human Clinical Data
Mechanism Description The mutations V550L and V550E in the FGFR4 kinase domain have been demonstrated to confer clinical resistance to erdafitinib in rhabdomyosarcoma, while V550M is associated with erdafitinib resistance in breast cancer.
Disease Class: Intrahepatic cholangiocarcinoma [1]
Resistant Disease Intrahepatic cholangiocarcinoma [ICD-11: 2C12.1]
Resistant Drug Erdafitinib
Molecule Alteration Missense mutation
p.V550L
Experimental Note Identified from the Human Clinical Data
Mechanism Description The mutations V550L and V550E in the FGFR4 kinase domain have been demonstrated to confer clinical resistance to erdafitinib in rhabdomyosarcoma, while V550M is associated with erdafitinib resistance in breast cancer.
Disease Class: Intrahepatic cholangiocarcinoma [1]
Resistant Disease Intrahepatic cholangiocarcinoma [ICD-11: 2C12.1]
Resistant Drug Erdafitinib
Molecule Alteration Missense mutation
p.V550E
Experimental Note Identified from the Human Clinical Data
Mechanism Description The mutations V550L and V550E in the FGFR4 kinase domain have been demonstrated to confer clinical resistance to erdafitinib in rhabdomyosarcoma, while V550M is associated with erdafitinib resistance in breast cancer.
Disease Class: Breast cancer [1]
Resistant Disease Breast cancer [ICD-11: 2C60.3]
Resistant Drug Erdafitinib
Molecule Alteration Missense mutation
p.V550M
Experimental Note Identified from the Human Clinical Data
Mechanism Description The mutations V550L and V550E in the FGFR4 kinase domain have been demonstrated to confer clinical resistance to erdafitinib in rhabdomyosarcoma, while V550M is associated with erdafitinib resistance in breast cancer.
Disease Class: Intrahepatic cholangiocarcinoma [1]
Resistant Disease Intrahepatic cholangiocarcinoma [ICD-11: 2C12.1]
Resistant Drug Erdafitinib
Molecule Alteration Missense mutation
p.V550L
Experimental Note Identified from the Human Clinical Data
Mechanism Description The mutations V550L and V550E in the FGFR4 kinase domain have been demonstrated to confer clinical resistance to erdafitinib in rhabdomyosarcoma, while V550M is associated with erdafitinib resistance in breast cancer.
Disease Class: Intrahepatic cholangiocarcinoma [1]
Resistant Disease Intrahepatic cholangiocarcinoma [ICD-11: 2C12.1]
Resistant Drug Erdafitinib
Molecule Alteration Missense mutation
p.V550E
Experimental Note Identified from the Human Clinical Data
Mechanism Description The mutations V550L and V550E in the FGFR4 kinase domain have been demonstrated to confer clinical resistance to erdafitinib in rhabdomyosarcoma, while V550M is associated with erdafitinib resistance in breast cancer.
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
PD173074
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Alveolar rhabdomyosarcoma [2]
Sensitive Disease Alveolar rhabdomyosarcoma [ICD-11: 2B55.0]
Sensitive Drug PD173074
Molecule Alteration Missense mutation
p.N535K (c.1605C>G)
Experimental Note Identified from the Human Clinical Data
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Click to Show/Hide the Resistance Disease of This Class
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Liver
The Specified Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.06E-04; Fold-change: 1.90E-01; Z-score: 5.56E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.25E-24; Fold-change: 5.62E-01; Z-score: 1.30E+00
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 3.24E-01; Fold-change: 1.36E-01; Z-score: 3.88E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Molecule expression in tissue other than the diseased tissue of patients
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Breast tissue
The Specified Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.61E-47; Fold-change: 2.84E-01; Z-score: 1.01E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.27E-06; Fold-change: 3.97E-01; Z-score: 8.41E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 Fibroblast growth factor receptors in cancer: genetic alterations, diagnostics, therapeutic targets and mechanisms of resistance .Br J Cancer. 2021 Mar;124(5):880-892. doi: 10.1038/s41416-020-01157-0. Epub 2020 Dec 3. 10.1038/s41416-020-01157-0
Ref 2 Targeting wild-type and mutationally activated FGFR4 in rhabdomyosarcoma with the inhibitor ponatinib (AP24534)PLoS One. 2013 Oct 4;8(10):e76551. doi: 10.1371/journal.pone.0076551. eCollection 2013.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.