Molecule Information
General Information of the Molecule (ID: Mol01837)
Name |
Fibroblast growth factor receptor 4 (FGFR4)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Fibroblast growth factor receptor 4; FGFR-4; CD antigen CD334; JTK2; TKF
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
FGFR4
|
||||
Gene ID | |||||
Location |
chr5:177,086,905-177,098,144[+]
|
||||
Sequence |
MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRA
ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDS LTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTA AAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ VVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVC TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEA LFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYG LMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDS VFSHDPLPLGSSSFPFGSGVQT Click to Show/Hide
|
||||
Function |
Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays a role in the regulation of cell proliferation, differentiation and migration, and in regulation of lipid metabolism, bile acid biosynthesis, glucose uptake, vitamin D metabolism and phosphate homeostasis. Required for normal down-regulation of the expression of CYP7A1, the rate-limiting enzyme in bile acid synthesis, in response to FGF19. Phosphorylates PLCG1 and FRS2. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Promotes SRC-dependent phosphorylation of the matrix protease MMP14 and its lysosomal degradation. FGFR4 signaling is down-regulated by receptor internalization and degradation; MMP14 promotes internalization and degradation of FGFR4. Mutations that lead to constitutive kinase activation or impair normal FGFR4 inactivation lead to aberrant signaling.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Breast cancer | [1] | |||
Resistant Disease | Breast cancer [ICD-11: 2C60.3] | |||
Resistant Drug | Erdafitinib | |||
Molecule Alteration | Missense mutation | p.V550M |
||
Experimental Note | Identified from the Human Clinical Data | |||
Mechanism Description | The mutations V550L and V550E in the FGFR4 kinase domain have been demonstrated to confer clinical resistance to erdafitinib in rhabdomyosarcoma, while V550M is associated with erdafitinib resistance in breast cancer. | |||
Disease Class: Intrahepatic cholangiocarcinoma | [1] | |||
Resistant Disease | Intrahepatic cholangiocarcinoma [ICD-11: 2C12.1] | |||
Resistant Drug | Erdafitinib | |||
Molecule Alteration | Missense mutation | p.V550L |
||
Experimental Note | Identified from the Human Clinical Data | |||
Mechanism Description | The mutations V550L and V550E in the FGFR4 kinase domain have been demonstrated to confer clinical resistance to erdafitinib in rhabdomyosarcoma, while V550M is associated with erdafitinib resistance in breast cancer. | |||
Disease Class: Intrahepatic cholangiocarcinoma | [1] | |||
Resistant Disease | Intrahepatic cholangiocarcinoma [ICD-11: 2C12.1] | |||
Resistant Drug | Erdafitinib | |||
Molecule Alteration | Missense mutation | p.V550E |
||
Experimental Note | Identified from the Human Clinical Data | |||
Mechanism Description | The mutations V550L and V550E in the FGFR4 kinase domain have been demonstrated to confer clinical resistance to erdafitinib in rhabdomyosarcoma, while V550M is associated with erdafitinib resistance in breast cancer. | |||
Disease Class: Breast cancer | [1] | |||
Resistant Disease | Breast cancer [ICD-11: 2C60.3] | |||
Resistant Drug | Erdafitinib | |||
Molecule Alteration | Missense mutation | p.V550M |
||
Experimental Note | Identified from the Human Clinical Data | |||
Mechanism Description | The mutations V550L and V550E in the FGFR4 kinase domain have been demonstrated to confer clinical resistance to erdafitinib in rhabdomyosarcoma, while V550M is associated with erdafitinib resistance in breast cancer. | |||
Disease Class: Intrahepatic cholangiocarcinoma | [1] | |||
Resistant Disease | Intrahepatic cholangiocarcinoma [ICD-11: 2C12.1] | |||
Resistant Drug | Erdafitinib | |||
Molecule Alteration | Missense mutation | p.V550L |
||
Experimental Note | Identified from the Human Clinical Data | |||
Mechanism Description | The mutations V550L and V550E in the FGFR4 kinase domain have been demonstrated to confer clinical resistance to erdafitinib in rhabdomyosarcoma, while V550M is associated with erdafitinib resistance in breast cancer. | |||
Disease Class: Intrahepatic cholangiocarcinoma | [1] | |||
Resistant Disease | Intrahepatic cholangiocarcinoma [ICD-11: 2C12.1] | |||
Resistant Drug | Erdafitinib | |||
Molecule Alteration | Missense mutation | p.V550E |
||
Experimental Note | Identified from the Human Clinical Data | |||
Mechanism Description | The mutations V550L and V550E in the FGFR4 kinase domain have been demonstrated to confer clinical resistance to erdafitinib in rhabdomyosarcoma, while V550M is associated with erdafitinib resistance in breast cancer. |
Investigative Drug(s)
1 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Alveolar rhabdomyosarcoma | [2] | |||
Sensitive Disease | Alveolar rhabdomyosarcoma [ICD-11: 2B55.0] | |||
Sensitive Drug | PD173074 | |||
Molecule Alteration | Missense mutation | p.N535K (c.1605C>G) |
||
Experimental Note | Identified from the Human Clinical Data |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Liver | |
The Specified Disease | Liver cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.06E-04; Fold-change: 1.90E-01; Z-score: 5.56E-01 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.25E-24; Fold-change: 5.62E-01; Z-score: 1.30E+00 | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 3.24E-01; Fold-change: 1.36E-01; Z-score: 3.88E-01 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Molecule expression in tissue other than the diseased tissue of patients
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Breast tissue | |
The Specified Disease | Breast cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.61E-47; Fold-change: 2.84E-01; Z-score: 1.01E+00 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 3.27E-06; Fold-change: 3.97E-01; Z-score: 8.41E-01 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
![]() |
||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.