Molecule Information
General Information of the Molecule (ID: Mol01829)
| Name |
Janus kinase 1 (JAK-1)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Janus kinase 1; JAK-1; JAK1; JAK1A; JAK1B
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
JAK1
|
||||
| Gene ID | |||||
| Location |
chr1:64,833,22965,067,754[-]
|
||||
| Sequence |
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEEL
CIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN DNEQSVWRHSPKKQKNGYEKKKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN WFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIR EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT CFEKSEQVQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFML KRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSG TLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL LLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA IMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP SGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIG DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDS DSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRT SFQNLIEGFEALLK Click to Show/Hide
|
||||
| Function |
Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway. Kinase partner for the interleukin (IL)-2 receptor as well as interleukin (IL)-10 receptor.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Cholangiocarcinoma | [1] | |||
| Sensitive Disease | Cholangiocarcinoma [ICD-11: 2C12.0] | |||
| Sensitive Drug | Ruxolitinib | |||
| Molecule Alteration | Missense mutation | p.S703I (c.2108G>T) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 |
| JAK1 cells | N.A. | . | N.A. | |
| In Vivo Model | mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blotting analysis | |||
| Experiment for Drug Resistance |
Tumor volume measurement assay | |||
| Disease Class: Acute lymphocytic leukemia | [2] | |||
| Sensitive Disease | Acute lymphocytic leukemia [ICD-11: 2B33.0] | |||
| Sensitive Drug | Ruxolitinib | |||
| Molecule Alteration | Missense mutation | p.S646F (c.1937C>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Bone marrow | . | ||
| In Vivo Model | Mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blotting analysis | |||
| Experiment for Drug Resistance |
Phosphoflow analysis | |||
| Mechanism Description | The missense mutation p.S646F (c.1937C>T) in gene JAK1 cause the sensitivity of Ruxolitinib by aberration of the drug's therapeutic target | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Liver | |
| The Specified Disease | Liver cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 8.35E-01; Fold-change: 2.90E-02; Z-score: 4.42E-02 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 7.63E-01; Fold-change: 1.73E-02; Z-score: 3.11E-02 | |
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 9.55E-01; Fold-change: 1.01E-01; Z-score: 1.35E-01 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Molecule expression in tissue other than the diseased tissue of patients
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
