Molecule Information

General Information of the Molecule (ID: Mol01825)

• Name: B-lymphocyte antigen CD19 (CD19) ,Homo sapiens
• Synonyms: B-lymphocyte surface antigen B4; Differentiation antigen CD19; T-cell surface antigen Leu-12; CD antigen CD19
• Molecule Type: Protein
• Gene Name: CD19
• Gene ID: 930
• Location: chr16:28931965-28939342[+]
• Sequence:
  MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKP
  FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGE
  LFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSL
  NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMW
  VMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYL
  IFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSG
  LGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF
  YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLS
  PHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGP
  DPAWGGGGRMGTWSTR
• Function: Functions as coreceptor for the B-cell antigen receptor complex (BCR) on B-lymphocytes. Decreases the threshold for activation of downstream signaling pathways and for triggering B-cell responses to antigens. Activates signaling pathways that lead to the activation of phosphatidylinositol 3-kinase and the mobilization of intracellular Ca(2+) stores. Is not required for early steps during B cell differentiation in the blood marrow. Required for normal differentiation of B-1 cells. Required for normal B cell differentiation and proliferation in response to antigen challenges. Required for normal levels of serum immunoglobulins, and for production of high-affinity antibodies in response to antigen challenge.
• Uniprot ID: CD19_HUMAN
• Ensembl ID: ENSG00000177455
• HGNC ID: HGNC:1633

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Loncastuximab tesirine

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Relapsed/refractory large B-cell lymphoma [1]

• Sensitive Disease: Relapsed/refractory large B-cell lymphoma [ICD-11: 2A81.1]
• Sensitive Drug: Loncastuximab tesirine
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• Cell Pathway Regulation: Cell apoptosis; Inhibition; hsa04210
• Cell Pathway Regulation: Cell invasion; Activation; hsa05200
• Cell Pathway Regulation: Cell viability; Activation; hsa05200
• In Vitro Model: VL51 cells; Lymph; Homo sapiens (Human); CVCL_3169
• Experiment for Molecule Alteration: Flow Cytometry and protein analyses
• Experiment for Drug Resistance: MTT assay
• Mechanism Description: The resistant cells had higher CD19 expression on their cell surface, which gave a much higher activity to the CD19 targeting antibody drug conjugate loncastuximab tesirine.

References

• Ref 1: Inotuzumab ozogamicin in pediatric patients with relapsed/refractory acute lymphoblastic leukemia Leukemia. 2019 Apr;33(4):884-892. doi: 10.1038/s41375-018-0265-z. Epub 2018 Sep 28.