General Information of the Molecule (ID: Mol01203)
Name
Aminoglycoside N(3)-acetyltransferase (AACC2) ,Pseudomonas aeruginosa
Molecule Type
Protein
Gene Name
AAC(3)-IIa
Sequence
MHTQKAITEALQKLGVQSGDLLMVHASLKSIGPVEGGAETVVAALRSAVGPTGTVMGYAS
WDRSPYEETLNGARLDDNARRTWPPFDPATAGTYRGFGLLNQFLVQAPGARRSAHPDASM
VAVGPLAETLTEPHELGHALGEGSPNERFVRLGGKALLLGAPLNSVTALHYAEAVADIPN
KRWVTYEMPMPGRDGEVAWKTASDYDSNGILDCFAIEGKQDAVETIANAYVKLGRHREGV
VGFAQCYLFDAQDIVTFGVTYLEKHFGTTPIVPAHEAIERSCEPSG
    Click to Show/Hide
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Pseudomonadales
Family: Pseudomonadaceae
Genus: Pseudomonas
Species: Pseudomonas aeruginosa
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Gentamicin B
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Gentamicin B
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Pseudomonas aeruginosa PAe1100 287
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description The AAC(3)-II AGRP is characterized by resistance to gentamicin, tobramycin, dibekacin, netilmicin, 2'-N-ethylnetilmicin, 6'-N-ethylnetilmicin, and sisomicin.
Gentamicin C
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Gentamicin C
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Pseudomonas aeruginosa PAe1100 287
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description The AAC(3)-II AGRP is characterized by resistance to gentamicin, tobramycin, dibekacin, netilmicin, 2'-N-ethylnetilmicin, 6'-N-ethylnetilmicin, and sisomicin.
References
Ref 1 Genes for gentamicin-(3)-N-acetyl-transferases III and IV. II. Nucleotide sequences of three AAC(3)-III genes and evolutionary aspects. Mol Gen Genet. 1985;198(3):514-20. doi: 10.1007/BF00332949.
Ref 2 Molecular genetics of aminoglycoside resistance genes and familial relationships of the aminoglycoside-modifying enzymes. Microbiol Rev. 1993 Mar;57(1):138-63. doi: 10.1128/mr.57.1.138-163.1993.
Ref 3 A TEM-derived extended-spectrum beta-lactamase in Pseudomonas aeruginosa. Antimicrob Agents Chemother. 1996 Nov;40(11):2488-93. doi: 10.1128/AAC.40.11.2488.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.