Molecule Information
General Information of the Molecule (ID: Mol01202)
Name |
Aminoglycoside N(3)-acetyltransferase (AACC2)
,Pseudomonas aeruginosa
|
||||
---|---|---|---|---|---|
Molecule Type |
Protein
|
||||
Gene Name |
AAC(3)-IIc
|
||||
Sequence |
MHTRKAITEALQKLGVQTGDLLMVHASLKAIGPVEGGAETVVAALRSAVGPTGTVMGYAS
WDRSPYEETRNGARLDDKTRRTWPPFDPATAGTYRGFGLLNQFLVQAPGARRSAHPDASM VAVGPLAETLTEPHKLGHALGEGSPVERFVRLGGKALLLGAPLNSVTALHYAEAVADIPN KRRVTYEMPMLGSNGEVAWKTASDYDSNGILDCFAIEGKPDAVETIANAYVKLGRHREGV VGFAQCYLFDAQDIVTFGVTYLEKHFGTTPIVPAHEVAECSCEPSG Click to Show/Hide
|
||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1], [2] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Gentamicin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli ATCC 25922 | 1322345 | ||
Pseudomonas aeruginosa ATCC 27853 | 287 | |||
Pseudomonas aeruginosa isolates | 287 | |||
Staphylococcus aureus ATCC 25923 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Various aminoglycoside modifying enzymes were associated with overlapping phenotypes: 36.5% strains produced AAC(6')-I with either a serine (GEN-TOB-NET) or a leucine (TOB-NET-AMk) at position 119, or both variants (GEN-TOB-NET-AMk); 21.2% expressed ANT(2")-I (GEN-TOB), 7.7% AAC(3)-II (GEN-TOB-NET), 5.8% AAC(3)-I (GEN) and 1.9% AAC(6')-II (GEN-TOB-NET-AMk) or AACA7 (TOB-NET-AMk). | |||
Disease Class: Folliculitis | [1], [2] | |||
Resistant Disease | Folliculitis [ICD-11: 1B74.0] | |||
Resistant Drug | Gentamicin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli ATCC 25922 | 1322345 | ||
Pseudomonas aeruginosa ATCC 27853 | 287 | |||
Pseudomonas aeruginosa isolates | 287 | |||
Staphylococcus aureus ATCC 25923 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Various aminoglycoside modifying enzymes were associated with overlapping phenotypes: 36.5% strains produced AAC(6')-I with either a serine (GEN-TOB-NET) or a leucine (TOB-NET-AMk) at position 119, or both variants (GEN-TOB-NET-AMk); 21.2% expressed ANT(2")-I (GEN-TOB), 7.7% AAC(3)-II (GEN-TOB-NET), 5.8% AAC(3)-I (GEN) and 1.9% AAC(6')-II (GEN-TOB-NET-AMk) or AACA7 (TOB-NET-AMk). | |||
Disease Class: Pseudomonas aeruginosa infection | [1], [2] | |||
Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Gentamicin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli ATCC 25922 | 1322345 | ||
Pseudomonas aeruginosa ATCC 27853 | 287 | |||
Pseudomonas aeruginosa isolates | 287 | |||
Staphylococcus aureus ATCC 25923 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Various aminoglycoside modifying enzymes were associated with overlapping phenotypes: 36.5% strains produced AAC(6')-I with either a serine (GEN-TOB-NET) or a leucine (TOB-NET-AMk) at position 119, or both variants (GEN-TOB-NET-AMk); 21.2% expressed ANT(2")-I (GEN-TOB), 7.7% AAC(3)-II (GEN-TOB-NET), 5.8% AAC(3)-I (GEN) and 1.9% AAC(6')-II (GEN-TOB-NET-AMk) or AACA7 (TOB-NET-AMk). | |||
Disease Class: Corneal ulcers | [1], [2] | |||
Resistant Disease | Corneal ulcers [ICD-11: 9A76.0] | |||
Resistant Drug | Gentamicin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli ATCC 25922 | 1322345 | ||
Pseudomonas aeruginosa ATCC 27853 | 287 | |||
Pseudomonas aeruginosa isolates | 287 | |||
Staphylococcus aureus ATCC 25923 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Various aminoglycoside modifying enzymes were associated with overlapping phenotypes: 36.5% strains produced AAC(6')-I with either a serine (GEN-TOB-NET) or a leucine (TOB-NET-AMk) at position 119, or both variants (GEN-TOB-NET-AMk); 21.2% expressed ANT(2")-I (GEN-TOB), 7.7% AAC(3)-II (GEN-TOB-NET), 5.8% AAC(3)-I (GEN) and 1.9% AAC(6')-II (GEN-TOB-NET-AMk) or AACA7 (TOB-NET-AMk). |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1], [2] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Netilmicin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli ATCC 25922 | 1322345 | ||
Pseudomonas aeruginosa ATCC 27853 | 287 | |||
Pseudomonas aeruginosa isolates | 287 | |||
Staphylococcus aureus ATCC 25923 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Various aminoglycoside modifying enzymes were associated with overlapping phenotypes: 36.5% strains produced AAC(6')-I with either a serine (GEN-TOB-NET) or a leucine (TOB-NET-AMk) at position 119, or both variants (GEN-TOB-NET-AMk); 21.2% expressed ANT(2")-I (GEN-TOB), 7.7% AAC(3)-II (GEN-TOB-NET), 5.8% AAC(3)-I (GEN) and 1.9% AAC(6')-II (GEN-TOB-NET-AMk) or AACA7 (TOB-NET-AMk). | |||
Disease Class: Folliculitis | [1], [2] | |||
Resistant Disease | Folliculitis [ICD-11: 1B74.0] | |||
Resistant Drug | Netilmicin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli ATCC 25922 | 1322345 | ||
Pseudomonas aeruginosa ATCC 27853 | 287 | |||
Pseudomonas aeruginosa isolates | 287 | |||
Staphylococcus aureus ATCC 25923 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Various aminoglycoside modifying enzymes were associated with overlapping phenotypes: 36.5% strains produced AAC(6')-I with either a serine (GEN-TOB-NET) or a leucine (TOB-NET-AMk) at position 119, or both variants (GEN-TOB-NET-AMk); 21.2% expressed ANT(2")-I (GEN-TOB), 7.7% AAC(3)-II (GEN-TOB-NET), 5.8% AAC(3)-I (GEN) and 1.9% AAC(6')-II (GEN-TOB-NET-AMk) or AACA7 (TOB-NET-AMk). | |||
Disease Class: Pseudomonas aeruginosa infection | [1], [2] | |||
Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Netilmicin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli ATCC 25922 | 1322345 | ||
Pseudomonas aeruginosa ATCC 27853 | 287 | |||
Pseudomonas aeruginosa isolates | 287 | |||
Staphylococcus aureus ATCC 25923 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Various aminoglycoside modifying enzymes were associated with overlapping phenotypes: 36.5% strains produced AAC(6')-I with either a serine (GEN-TOB-NET) or a leucine (TOB-NET-AMk) at position 119, or both variants (GEN-TOB-NET-AMk); 21.2% expressed ANT(2")-I (GEN-TOB), 7.7% AAC(3)-II (GEN-TOB-NET), 5.8% AAC(3)-I (GEN) and 1.9% AAC(6')-II (GEN-TOB-NET-AMk) or AACA7 (TOB-NET-AMk). | |||
Disease Class: Corneal ulcers | [1], [2] | |||
Resistant Disease | Corneal ulcers [ICD-11: 9A76.0] | |||
Resistant Drug | Netilmicin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli ATCC 25922 | 1322345 | ||
Pseudomonas aeruginosa ATCC 27853 | 287 | |||
Pseudomonas aeruginosa isolates | 287 | |||
Staphylococcus aureus ATCC 25923 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Various aminoglycoside modifying enzymes were associated with overlapping phenotypes: 36.5% strains produced AAC(6')-I with either a serine (GEN-TOB-NET) or a leucine (TOB-NET-AMk) at position 119, or both variants (GEN-TOB-NET-AMk); 21.2% expressed ANT(2")-I (GEN-TOB), 7.7% AAC(3)-II (GEN-TOB-NET), 5.8% AAC(3)-I (GEN) and 1.9% AAC(6')-II (GEN-TOB-NET-AMk) or AACA7 (TOB-NET-AMk). |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1], [2] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Tobramycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli ATCC 25922 | 1322345 | ||
Pseudomonas aeruginosa ATCC 27853 | 287 | |||
Pseudomonas aeruginosa isolates | 287 | |||
Staphylococcus aureus ATCC 25923 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Various aminoglycoside modifying enzymes were associated with overlapping phenotypes: 36.5% strains produced AAC(6')-I with either a serine (GEN-TOB-NET) or a leucine (TOB-NET-AMk) at position 119, or both variants (GEN-TOB-NET-AMk); 21.2% expressed ANT(2")-I (GEN-TOB), 7.7% AAC(3)-II (GEN-TOB-NET), 5.8% AAC(3)-I (GEN) and 1.9% AAC(6')-II (GEN-TOB-NET-AMk) or AACA7 (TOB-NET-AMk). | |||
Disease Class: Folliculitis | [1], [2] | |||
Resistant Disease | Folliculitis [ICD-11: 1B74.0] | |||
Resistant Drug | Tobramycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli ATCC 25922 | 1322345 | ||
Pseudomonas aeruginosa ATCC 27853 | 287 | |||
Pseudomonas aeruginosa isolates | 287 | |||
Staphylococcus aureus ATCC 25923 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Various aminoglycoside modifying enzymes were associated with overlapping phenotypes: 36.5% strains produced AAC(6')-I with either a serine (GEN-TOB-NET) or a leucine (TOB-NET-AMk) at position 119, or both variants (GEN-TOB-NET-AMk); 21.2% expressed ANT(2")-I (GEN-TOB), 7.7% AAC(3)-II (GEN-TOB-NET), 5.8% AAC(3)-I (GEN) and 1.9% AAC(6')-II (GEN-TOB-NET-AMk) or AACA7 (TOB-NET-AMk). | |||
Disease Class: Pseudomonas aeruginosa infection | [1], [2] | |||
Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Tobramycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli ATCC 25922 | 1322345 | ||
Pseudomonas aeruginosa ATCC 27853 | 287 | |||
Pseudomonas aeruginosa isolates | 287 | |||
Staphylococcus aureus ATCC 25923 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Various aminoglycoside modifying enzymes were associated with overlapping phenotypes: 36.5% strains produced AAC(6')-I with either a serine (GEN-TOB-NET) or a leucine (TOB-NET-AMk) at position 119, or both variants (GEN-TOB-NET-AMk); 21.2% expressed ANT(2")-I (GEN-TOB), 7.7% AAC(3)-II (GEN-TOB-NET), 5.8% AAC(3)-I (GEN) and 1.9% AAC(6')-II (GEN-TOB-NET-AMk) or AACA7 (TOB-NET-AMk). | |||
Disease Class: Corneal ulcers | [1], [2] | |||
Resistant Disease | Corneal ulcers [ICD-11: 9A76.0] | |||
Resistant Drug | Tobramycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli ATCC 25922 | 1322345 | ||
Pseudomonas aeruginosa ATCC 27853 | 287 | |||
Pseudomonas aeruginosa isolates | 287 | |||
Staphylococcus aureus ATCC 25923 | 1280 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | Various aminoglycoside modifying enzymes were associated with overlapping phenotypes: 36.5% strains produced AAC(6')-I with either a serine (GEN-TOB-NET) or a leucine (TOB-NET-AMk) at position 119, or both variants (GEN-TOB-NET-AMk); 21.2% expressed ANT(2")-I (GEN-TOB), 7.7% AAC(3)-II (GEN-TOB-NET), 5.8% AAC(3)-I (GEN) and 1.9% AAC(6')-II (GEN-TOB-NET-AMk) or AACA7 (TOB-NET-AMk). |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.