General Information of the Molecule (ID: Mol01196)
Name
Aminoglycoside 3'-phosphotransferase (A3AP) ,Escherichia coli
Molecule Type
Protein
Gene Name
APH(4)-Ia
Sequence
MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKD
RYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEAMD
AIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDE
LMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMFGDSQYEVANIFFWRPWLA
CMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSG
AGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAKE
    Click to Show/Hide
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Hygromycin B
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Escherichia coli infection [ICD-11: 1A03.0] [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Hygromycin B
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain BE904 562
Escherichia coli strain CSR603 562
Escherichia coli strain DH1 536056
Escherichia coli strain JA221 562
Escherichia coli strain k12 83333
Escherichia coli strain RR1 562
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
O-galactosidase assay
Mechanism Description Hygromycin B resistance is mediated by an aminocyc1ito1 phosphotransferase that inactivates by covalent addition of a phosphate to the 4-position of hygromycin B. The gene is abbreviated as aph(4).
References
Ref 1 Analysis of a bacterial hygromycin B resistance gene by transcriptional and translational fusions and by DNA sequencing. Nucleic Acids Res. 1983 Oct 11;11(19):6895-911. doi: 10.1093/nar/11.19.6895.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.