General Information of the Molecule (ID: Mol01194)
Name
Acetylpolyamine amidohydrolase (APAH) ,Achromobacter xylosoxydanssubsp.denitrificans
Molecule Type
Protein
Gene Name
aphA15
Sequence
MTVALDEVSELKNLLSPLLDECTFEEVEYGQSDARVIRVLFPDRNTAYLKYASGSSAQEI
LQEHQRTRWLRTRALVPEVISYVSTSTVTILLTKALIGHNAADAADADPVIVVAEMARAL
RDLHSISPDDCPFDERLHLRLKLASGRLEAGLVDEEDFDHARQGMLARDVYEQLFIQMPG
AEQLVVTHGDACPENFIFQGNAFVGFIDCGRVGLADKYQDLALASRNIDAVFGPELTNQF
FIEYGEPNPNIAKIEYYRILDEFF
    Click to Show/Hide
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Betaproteobacteria
Order: Burkholderiales
Family: Alcaligenaceae
Genus: Achromobacter
Species: Achromobacter denitrificans
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
7 drug(s) in total
Click to Show/Hide the Full List of Drugs
Amikacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Achromobacter xylosoxydans infection [1]
Resistant Disease Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z]
Resistant Drug Amikacin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Achromobacter xylosoxydans subsp. denitrificans AX-22 85698
Escherichia coli MkD-135 562
Pseudomonas aeruginosa 10145/3 287
Experiment for
Molecule Alteration
DNA extraction and Sequencing assay
Experiment for
Drug Resistance
Macrodilution broth method assay
Mechanism Description The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin.
Disease Class: Escherichia coli infection [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Amikacin
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Achromobacter xylosoxydans subsp. denitrificans AX-22 85698
Escherichia coli MkD-135 562
Pseudomonas aeruginosa 10145/3 287
Experiment for
Molecule Alteration
DNA extraction and Sequencing assay
Experiment for
Drug Resistance
Macrodilution broth method assay
Mechanism Description The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin.
Framycetin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Escherichia coli infection [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Framycetin
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Achromobacter xylosoxydans subsp. denitrificans AX-22 85698
Escherichia coli MkD-135 562
Pseudomonas aeruginosa 10145/3 287
Experiment for
Molecule Alteration
DNA extraction and Sequencing assay
Experiment for
Drug Resistance
Macrodilution broth method assay
Mechanism Description The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin.
Gentamicin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Achromobacter xylosoxydans infection [1]
Resistant Disease Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z]
Resistant Drug Gentamicin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Achromobacter xylosoxydans subsp. denitrificans AX-22 85698
Escherichia coli MkD-135 562
Pseudomonas aeruginosa 10145/3 287
Experiment for
Molecule Alteration
DNA extraction and Sequencing assay
Experiment for
Drug Resistance
Macrodilution broth method assay
Mechanism Description The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin.
Kanamycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Escherichia coli infection [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Kanamycin
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Achromobacter xylosoxydans subsp. denitrificans AX-22 85698
Escherichia coli MkD-135 562
Pseudomonas aeruginosa 10145/3 287
Experiment for
Molecule Alteration
DNA extraction and Sequencing assay
Experiment for
Drug Resistance
Macrodilution broth method assay
Mechanism Description The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin.
Netilmicin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Achromobacter xylosoxydans infection [1]
Resistant Disease Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z]
Resistant Drug Netilmicin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Achromobacter xylosoxydans subsp. denitrificans AX-22 85698
Escherichia coli MkD-135 562
Pseudomonas aeruginosa 10145/3 287
Experiment for
Molecule Alteration
DNA extraction and Sequencing assay
Experiment for
Drug Resistance
Macrodilution broth method assay
Mechanism Description The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin.
Disease Class: Escherichia coli infection [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Netilmicin
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Achromobacter xylosoxydans subsp. denitrificans AX-22 85698
Escherichia coli MkD-135 562
Pseudomonas aeruginosa 10145/3 287
Experiment for
Molecule Alteration
DNA extraction and Sequencing assay
Experiment for
Drug Resistance
Macrodilution broth method assay
Mechanism Description The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin.
Streptomycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Escherichia coli infection [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Streptomycin
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Achromobacter xylosoxydans subsp. denitrificans AX-22 85698
Escherichia coli MkD-135 562
Pseudomonas aeruginosa 10145/3 287
Experiment for
Molecule Alteration
DNA extraction and Sequencing assay
Experiment for
Drug Resistance
Macrodilution broth method assay
Mechanism Description The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin.
Tobramycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Achromobacter xylosoxydans infection [1]
Resistant Disease Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z]
Resistant Drug Tobramycin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli 668369
Achromobacter xylosoxydans subsp. denitrificans AX-22 85698
Escherichia coli MkD-135 562
Pseudomonas aeruginosa 10145/3 287
Experiment for
Molecule Alteration
DNA extraction and Sequencing assay
Experiment for
Drug Resistance
Macrodilution broth method assay
Mechanism Description The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin.
References
Ref 1 In70 of plasmid pAX22, a bla(VIM-1)-containing integron carrying a new aminoglycoside phosphotransferase gene cassette. Antimicrob Agents Chemother. 2001 Apr;45(4):1249-53. doi: 10.1128/AAC.45.4.1249-1253.2001.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.