Molecule Information
General Information of the Molecule (ID: Mol01194)
Name |
Acetylpolyamine amidohydrolase (APAH)
,Achromobacter xylosoxydanssubsp.denitrificans
|
||||
---|---|---|---|---|---|
Molecule Type |
Protein
|
||||
Gene Name |
aphA15
|
||||
Sequence |
MTVALDEVSELKNLLSPLLDECTFEEVEYGQSDARVIRVLFPDRNTAYLKYASGSSAQEI
LQEHQRTRWLRTRALVPEVISYVSTSTVTILLTKALIGHNAADAADADPVIVVAEMARAL RDLHSISPDDCPFDERLHLRLKLASGRLEAGLVDEEDFDHARQGMLARDVYEQLFIQMPG AEQLVVTHGDACPENFIFQGNAFVGFIDCGRVGLADKYQDLALASRNIDAVFGPELTNQF FIEYGEPNPNIAKIEYYRILDEFF Click to Show/Hide
|
||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
7 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Achromobacter xylosoxydans infection | [1] | |||
Resistant Disease | Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Amikacin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli | 668369 | ||
Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
Escherichia coli MkD-135 | 562 | |||
Pseudomonas aeruginosa 10145/3 | 287 | |||
Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
Experiment for Drug Resistance |
Macrodilution broth method assay | |||
Mechanism Description | The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin. | |||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Amikacin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli | 668369 | ||
Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
Escherichia coli MkD-135 | 562 | |||
Pseudomonas aeruginosa 10145/3 | 287 | |||
Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
Experiment for Drug Resistance |
Macrodilution broth method assay | |||
Mechanism Description | The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Framycetin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli | 668369 | ||
Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
Escherichia coli MkD-135 | 562 | |||
Pseudomonas aeruginosa 10145/3 | 287 | |||
Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
Experiment for Drug Resistance |
Macrodilution broth method assay | |||
Mechanism Description | The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Achromobacter xylosoxydans infection | [1] | |||
Resistant Disease | Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Gentamicin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli | 668369 | ||
Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
Escherichia coli MkD-135 | 562 | |||
Pseudomonas aeruginosa 10145/3 | 287 | |||
Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
Experiment for Drug Resistance |
Macrodilution broth method assay | |||
Mechanism Description | The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Kanamycin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli | 668369 | ||
Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
Escherichia coli MkD-135 | 562 | |||
Pseudomonas aeruginosa 10145/3 | 287 | |||
Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
Experiment for Drug Resistance |
Macrodilution broth method assay | |||
Mechanism Description | The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Achromobacter xylosoxydans infection | [1] | |||
Resistant Disease | Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Netilmicin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli | 668369 | ||
Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
Escherichia coli MkD-135 | 562 | |||
Pseudomonas aeruginosa 10145/3 | 287 | |||
Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
Experiment for Drug Resistance |
Macrodilution broth method assay | |||
Mechanism Description | The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin. | |||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Netilmicin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli | 668369 | ||
Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
Escherichia coli MkD-135 | 562 | |||
Pseudomonas aeruginosa 10145/3 | 287 | |||
Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
Experiment for Drug Resistance |
Macrodilution broth method assay | |||
Mechanism Description | The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Escherichia coli infection | [1] | |||
Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
Resistant Drug | Streptomycin | |||
Molecule Alteration | Expression | Acquired |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli | 668369 | ||
Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
Escherichia coli MkD-135 | 562 | |||
Pseudomonas aeruginosa 10145/3 | 287 | |||
Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
Experiment for Drug Resistance |
Macrodilution broth method assay | |||
Mechanism Description | The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Achromobacter xylosoxydans infection | [1] | |||
Resistant Disease | Achromobacter xylosoxydans infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Tobramycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli | 668369 | ||
Achromobacter xylosoxydans subsp. denitrificans AX-22 | 85698 | |||
Escherichia coli MkD-135 | 562 | |||
Pseudomonas aeruginosa 10145/3 | 287 | |||
Experiment for Molecule Alteration |
DNA extraction and Sequencing assay | |||
Experiment for Drug Resistance |
Macrodilution broth method assay | |||
Mechanism Description | The aphA15 gene is the first example of an aph-like gene carried on a mobile gene cassette, and its product exhibits close similarity to the APH(3')-IIa aminoglycoside phosphotransferase encoded by Tn5 (36% amino acid identity) and to an APH(3')-IIb enzyme from Pseudomonas aeruginosa (38% amino acid identity). Expression of the cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin as well as (slightly) to amikacin, netilmicin, and streptomycin. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.