General Information of the Molecule (ID: Mol01174)
Name
Transcriptional regulatory protein LiaR (LIAR) ,Enterococcus faecalis
Molecule Type
Protein
Gene Name
liaR
Sequence
MIKVLLVDDHEMVRLGVSSYLSIQEDIEVIGEAENGRQGYEKAMTLRPDVILMDLVMEEM
DGIESTKAILKDWPEAKIIIVTSFIDDEKVYPAIEAGAAGYLLKTSTAHEIADAIRATQR
GERVLEPEVTTKMMEKMSRRNEPVLHEELTNRENEILMLISEGKSNQEIADELFITLKTV
KTHVSNILAKLEVEDRTQAAIYAFKHGLVK
    Click to Show/Hide
Function
liaR is a response regulator found in the liaFSR signal transduction pathway. Mutations confer daptomycin resistance.
    Click to Show/Hide
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Enterococcaceae
Genus: Enterococcus
Species: Enterococcus faecalis
Type(s) of Resistant Mechanism of This Molecule
  EADR: Epigenetic Alteration of DNA, RNA or Protein
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Daptomycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Epigenetic Alteration of DNA, RNA or Protein (EADR) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Daptomycin
Molecule Alteration Missense mutation
p.D191N
Experimental Note Identified from the Human Clinical Data
In Vitro Model Enterococcus faecalis S613 699185
Experiment for
Molecule Alteration
Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description LiaFSR is a component of the CESR regulon and responds to changes in cell envelope integrity by regulating downstream genes to counteract damage.LiaFSR mutations occurred in liaF (78%), with changes in yvlB (12%) and liaR (4%) comprising the remainder.
References
Ref 1 Adaptation of Enterococcus faecalis to daptomycin reveals an ordered progression to resistance. Antimicrob Agents Chemother. 2013 Nov;57(11):5373-83. doi: 10.1128/AAC.01473-13. Epub 2013 Aug 19.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.