General Information of the Molecule (ID: Mol01172)
Name
Colistin resistance protein (MCR-3.3-Unclear) ,Aeromonas veronii
Molecule Type
Protein
Gene Name
MCR-3.3
Sequence
MPSLIKIKIVPLMFFLALYFAFMLNWRGVLHFYEILYKLEDFKFGFAISLPILLVAALNF
VFVPFSIRYLIKPFFALLIALSAIVSYTMMKYRVLFDQNMIQNIFETNQNEALAYLSLPI
IGWVTIAGFIPAILLFFVEIEYEEKWFKGILTRALSMFASLIVIAVIAALYYQDYVSVGR
NNSNLQREIVPANFVNSTVKYVYNRYLAEPIPFTTLGDDAKRDTNQSKPTLMFLVVGETA
RGKNFSMNGYEKDTNPFTSKSGGVISFNDVRSCGTATAVSVPCMFSNMGRKEFDDNLARN
SEGLLDVLQKTGVSIFWKENDGGCKGVCDRVPNIEIKPKDYPKFCDKNTCYDEVVLQELD
SEIAQMKGDKLVGFHLIGSHGPTYYKRYPDAHRQFTPDCPRSDIENCTDEELTNTYDNTI
RYTDFVIAEMIAKLKTYEDKYNTALLYVSDHGESLGALGLYLHGTPYKFAPDDQTRVPMQ
VWMSPGFIKEKGMNMECLQKNAAANRYSHDNIFSSVLGIWDVKTAIYEQELDIFKQCRNN
    Click to Show/Hide
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Aeromonadales
Family: Aeromonadaceae
Genus: Aeromonas
Species: Aeromonas veronii
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Colistin A
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Gram-negative bacterial infection [1]
Resistant Disease Gram-negative bacterial infection [ICD-11: 1B74-1G40]
Resistant Drug Colistin A
Molecule Alteration Mutation
.
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli ATCC 25922 1322345
Aeromonas veronii 172 654
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description This strain showed resistance to both Beta-lactams and phenicols and had borderline susceptibility to colistin, which was mediated by mcr-3.3 alone.
Colistin B
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Gram-negative bacterial infection [1]
Resistant Disease Gram-negative bacterial infection [ICD-11: 1B74-1G40]
Resistant Drug Colistin B
Molecule Alteration Mutation
.
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Escherichia coli ATCC 25922 1322345
Aeromonas veronii 172 654
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description This strain showed resistance to both Beta-lactams and phenicols and had borderline susceptibility to colistin, which was mediated by mcr-3.3 alone.
References
Ref 1 Chromosome-Mediated mcr-3 Variants in Aeromonas veronii from Chicken Meat. Antimicrob Agents Chemother. 2017 Oct 24;61(11):e01272-17. doi: 10.1128/AAC.01272-17. Print 2017 Nov.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.