General Information of the Molecule (ID: Mol01134)
Name
Viomycin phosphotransferase (VPH) ,Streptomyces vinaceus
Synonyms
Viomycin kinase
    Click to Show/Hide
Molecule Type
Protein
Gene Name
vph
Gene ID
63984161
Sequence
MRIIETHRDLLSRLLPGDTVGGLAVHEGQFHHVVIGSHRVVCFARTRAAADRLPGRADVL
RALAGIDLGFRTPQPLSEGGAQGTDEPPYLVLSRIPGAPLEDDVLTSPEVAEAVARQYAT
LLSGLAAAGDEEKVRAALPEAPANEWQEFATGVRTELFPLMSDGGRERAERELAALDALP
HLTSAVVHGDLGGENVLWETVDGVPRMSGVVDWDEVGIGDPAEDLAAIGASYGEELLGRV
LALGGWADNGTAERISAIRGTFALQQALYAQRDGDEEELADGLSGYR
    Click to Show/Hide
Function
The aminoglycoside phosphotransferases achieve inactivation of their antibiotic substrates by phosphorylation.
    Click to Show/Hide
Uniprot ID
VPH_STRVI
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Streptomycetales
Family: Streptomycetaceae
Genus: Streptomyces
Species: Streptomyces vinaceus
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Viomycin sulfate
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Escherichia coli infection [ICD-11: 1A03.0] [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Viomycin sulfate
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli JM109 562
Escherichia coli strain ED8767 562
Streptomyces lividans strain M252 1916
Streptomyces lividans strain 66 1200984
Escherichia coli strain W5445 562
Streptomyces lividans strain M264 1916
Streptomyces lividans strain M274 1916
Experiment for
Molecule Alteration
DNA sequencing assay
Mechanism Description Insertion of the BamHI fragment containing this sequence (vph) into the unique BamHI site of pBR322, in one orientation, led to expression of viomycin resistance in Escherichia coli.
Disease Class: Streptomyces vinaceus infection [ICD-11: 1C43.11] [1]
Resistant Disease Streptomyces vinaceus infection [ICD-11: 1C43.11]
Resistant Drug Viomycin sulfate
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli JM109 562
Escherichia coli strain ED8767 562
Streptomyces lividans strain M252 1916
Streptomyces lividans strain 66 1200984
Escherichia coli strain W5445 562
Streptomyces lividans strain M264 1916
Streptomyces lividans strain M274 1916
Experiment for
Molecule Alteration
DNA sequencing assay
Mechanism Description Promoter-probe plasmid vectors were used to isolate putative promoter-containing DNA fragments of three Streptomyces antibiotic resistance genes, the rRNA methylase (tsr) gene of S. azureus, the aminoglycoside phosphotransferase (aph) gene of S. fradiae, and the viomycin phosphotransferase (vph) gene of S. vinaceus.
References
Ref 1 Nucleotide sequences encoding and promoting expression of three antibiotic resistance genes indigenous to Streptomyces. Mol Gen Genet. 1985;199(1):26-36. doi: 10.1007/BF00327505.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.