Molecule Information
General Information of the Molecule (ID: Mol01134)
| Name |
Viomycin phosphotransferase (VPH)
,Streptomyces vinaceus
|
||||
|---|---|---|---|---|---|
| Synonyms |
Viomycin kinase
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
vph
|
||||
| Gene ID | |||||
| Sequence |
MRIIETHRDLLSRLLPGDTVGGLAVHEGQFHHVVIGSHRVVCFARTRAAADRLPGRADVL
RALAGIDLGFRTPQPLSEGGAQGTDEPPYLVLSRIPGAPLEDDVLTSPEVAEAVARQYAT LLSGLAAAGDEEKVRAALPEAPANEWQEFATGVRTELFPLMSDGGRERAERELAALDALP HLTSAVVHGDLGGENVLWETVDGVPRMSGVVDWDEVGIGDPAEDLAAIGASYGEELLGRV LALGGWADNGTAERISAIRGTFALQQALYAQRDGDEEELADGLSGYR Click to Show/Hide
|
||||
| Function |
The aminoglycoside phosphotransferases achieve inactivation of their antibiotic substrates by phosphorylation.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Escherichia coli infection [ICD-11: 1A03.0] | [1] | |||
| Resistant Disease | Escherichia coli infection [ICD-11: 1A03.0] | |||
| Resistant Drug | Viomycin sulfate | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli JM109 | 562 | ||
| Escherichia coli strain ED8767 | 562 | |||
| Streptomyces lividans strain M252 | 1916 | |||
| Streptomyces lividans strain 66 | 1200984 | |||
| Escherichia coli strain W5445 | 562 | |||
| Streptomyces lividans strain M264 | 1916 | |||
| Streptomyces lividans strain M274 | 1916 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Mechanism Description | Insertion of the BamHI fragment containing this sequence (vph) into the unique BamHI site of pBR322, in one orientation, led to expression of viomycin resistance in Escherichia coli. | |||
| Disease Class: Streptomyces vinaceus infection [ICD-11: 1C43.11] | [1] | |||
| Resistant Disease | Streptomyces vinaceus infection [ICD-11: 1C43.11] | |||
| Resistant Drug | Viomycin sulfate | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli JM109 | 562 | ||
| Escherichia coli strain ED8767 | 562 | |||
| Streptomyces lividans strain M252 | 1916 | |||
| Streptomyces lividans strain 66 | 1200984 | |||
| Escherichia coli strain W5445 | 562 | |||
| Streptomyces lividans strain M264 | 1916 | |||
| Streptomyces lividans strain M274 | 1916 | |||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Mechanism Description | Promoter-probe plasmid vectors were used to isolate putative promoter-containing DNA fragments of three Streptomyces antibiotic resistance genes, the rRNA methylase (tsr) gene of S. azureus, the aminoglycoside phosphotransferase (aph) gene of S. fradiae, and the viomycin phosphotransferase (vph) gene of S. vinaceus. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
