Molecule Information

General Information of the Molecule (ID: Mol01133)

• Name: Undecaprenyl-diphosphatase BcrC (BCRC) ,Bacillus subtilis
• Synonyms: Undecaprenyl pyrophosphate phosphatase; ywoA; BSU36530
• Molecule Type: Protein
• Gene Name: bcrC
• Gene ID: 936946
• Sequence:
  MNYEIFKAIHGLSHHNSVLDSIMVFITEYAIVAYALILLAIWLFGNTQSRKHVLYAGITG
  IAGLVINYLITLVYFEPRPFVAHTVHTLIPHAADASFPSDHTTGALAISIAMLFRNRKIG
  WPLVIFGLLTGFSRIWVGHHYPVDVLGSLVVAIIIGFLFFRFSDLLRPFVDLVVRIYEAI
  INKLTKKPTDQNF
• Function: Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
• Uniprot ID: BCRC_BACSU

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Bacillales
Family: Bacillaceae
Genus: Bacillus
Species: Bacillus subtilis

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 3 drug(s) in total

Bacitracin A

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacillus subtilis infection [ICD-11: 1G40.1] [1]

• Resistant Disease: Bacillus subtilis infection [ICD-11: 1G40.1]
• Resistant Drug: Bacitracin A
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli C41(DE3); 469008
• In Vitro Model: Escherichia coli DH5alpha; 668369
• In Vitro Model: Bacillus subtilis 168; 224308
• In Vitro Model: Bacillus subtilis BFS82; 1423
• In Vitro Model: Bacillus subtilis BSmrs168; 1423
• In Vitro Model: Bacillus subtilis BSmrs173; 1423
• In Vitro Model: Bacillus subtilis BSmrs175; 1423
• In Vitro Model: Bacillus subtilis BSmrs194; 1423
• In Vitro Model: Bacillus subtilis BSmrs201; 1423
• In Vitro Model: Escherichia coli Ecmrs144; 562
• In Vitro Model: Escherichia coli Ecmrs150; 562
• In Vitro Model: Escherichia coli Ecmrs151; 562
• Experiment for Molecule Alteration: PCR amplification and DNA sequence assay
• Experiment for Drug Resistance: Microtiter tray assay
• Mechanism Description: Overexpression of the BcrCBs protein, formerly called YwoA, in Escherichia coli or in Bacillus subtilis allows these bacteria to stand higher concentrations of bacitracin.

Bacitracin F

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacillus subtilis infection [ICD-11: 1G40.1] [1]

• Resistant Disease: Bacillus subtilis infection [ICD-11: 1G40.1]
• Resistant Drug: Bacitracin F
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli C41(DE3); 469008
• In Vitro Model: Escherichia coli DH5alpha; 668369
• In Vitro Model: Bacillus subtilis 168; 224308
• In Vitro Model: Bacillus subtilis BFS82; 1423
• In Vitro Model: Bacillus subtilis BSmrs168; 1423
• In Vitro Model: Bacillus subtilis BSmrs173; 1423
• In Vitro Model: Bacillus subtilis BSmrs175; 1423
• In Vitro Model: Bacillus subtilis BSmrs194; 1423
• In Vitro Model: Bacillus subtilis BSmrs201; 1423
• In Vitro Model: Escherichia coli Ecmrs144; 562
• In Vitro Model: Escherichia coli Ecmrs150; 562
• In Vitro Model: Escherichia coli Ecmrs151; 562
• Experiment for Molecule Alteration: PCR amplification and DNA sequence assay
• Experiment for Drug Resistance: Microtiter tray assay
• Mechanism Description: Overexpression of the BcrCBs protein, formerly called YwoA, in Escherichia coli or in Bacillus subtilis allows these bacteria to stand higher concentrations of bacitracin.

Bacitracin methylene disalicylate

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacillus subtilis infection [ICD-11: 1G40.1] [1]

• Resistant Disease: Bacillus subtilis infection [ICD-11: 1G40.1]
• Resistant Drug: Bacitracin methylene disalicylate
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli C41(DE3); 469008
• In Vitro Model: Escherichia coli DH5alpha; 668369
• In Vitro Model: Bacillus subtilis 168; 224308
• In Vitro Model: Bacillus subtilis BFS82; 1423
• In Vitro Model: Bacillus subtilis BSmrs168; 1423
• In Vitro Model: Bacillus subtilis BSmrs173; 1423
• In Vitro Model: Bacillus subtilis BSmrs175; 1423
• In Vitro Model: Bacillus subtilis BSmrs194; 1423
• In Vitro Model: Bacillus subtilis BSmrs201; 1423
• In Vitro Model: Escherichia coli Ecmrs144; 562
• In Vitro Model: Escherichia coli Ecmrs150; 562
• In Vitro Model: Escherichia coli Ecmrs151; 562
• Experiment for Molecule Alteration: PCR amplification and DNA sequence assay
• Experiment for Drug Resistance: Microtiter tray assay
• Mechanism Description: Overexpression of the BcrCBs protein, formerly called YwoA, in Escherichia coli or in Bacillus subtilis allows these bacteria to stand higher concentrations of bacitracin.

References

• Ref 1: BcrC from Bacillus subtilis acts as an undecaprenyl pyrophosphate phosphatase in bacitracin resistance. J Biol Chem. 2005 Aug 12;280(32):28852-7. doi: 10.1074/jbc.M413750200. Epub 2005 Jun 9.