Molecule Information
General Information of the Molecule (ID: Mol01124)
| Name |
Transport protein (ALL3255)
,Nostoc punctiforme PCC 73102
|
||||
|---|---|---|---|---|---|
| Synonyms |
all3255; Transport protein
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
all3255
|
||||
| Sequence |
MNQLLTAFTESLVAFAATNIDDIIILLLLFSQVDVNFRRSHIWVGHFLGFLIIILASLPG
FFGGLFVQREFIGLLGILPIIIGIKKLVKKDQENTQIQAVTTDLKGSSPANPILAFISSI LHPQVYKVGAVTVANGGDNISIYIPLFAGQNLVTLGVIIGVFFFMVGILCVTADLLSRQA PIAYVLSLHSKTFIPFILIALGLFIMYERGTFSLLMSIKI Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Investigative Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Cadmium | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | Anabaena sp. PCC7120 | 1167 | ||
| Escherichia coli BL21 (DE3) | 469008 | |||
| Experiment for Molecule Alteration |
Immunoblotting analysis | |||
| Experiment for Drug Resistance |
Liquid culture assay | |||
| Mechanism Description | PCC7120 a homolog of cadmium resistance-associated protein (CadD) involved in cadmium or heavy metal resistance or not, cloning and heterologous expression analysis of all3255 performed in Escherichia coli BL21 (DE3). Our results revealed that the strain transformed with pGEX-5X-2 + all3255 showed resistant towards not only to cadmium but also other heavy metals such as nickel, copper, zinc, lead and cobalt in addition to arsenic than those of transformed with empty vector (pGEX-5X-2). | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
