Molecule Information

General Information of the Molecule (ID: Mol01124)

• Name: Transport protein (ALL3255) ,Nostoc punctiforme PCC 73102
• Synonyms: all3255; Transport protein
• Molecule Type: Protein
• Gene Name: all3255
• Sequence:
  MNQLLTAFTESLVAFAATNIDDIIILLLLFSQVDVNFRRSHIWVGHFLGFLIIILASLPG
  FFGGLFVQREFIGLLGILPIIIGIKKLVKKDQENTQIQAVTTDLKGSSPANPILAFISSI
  LHPQVYKVGAVTVANGGDNISIYIPLFAGQNLVTLGVIIGVFFFMVGILCVTADLLSRQA
  PIAYVLSLHSKTFIPFILIALGLFIMYERGTFSLLMSIKI
• Uniprot ID: Q8YS36_NOSS1

Kingdom: N.A.
Phylum: Cyanobacteria
Class: .
Order: Nostocales
Family: Nostocaceae
Genus: Nostoc
Species: Nostoc punctiforme PCC 73102

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Investigative Drug(s) 1 drug(s) in total

Cadmium

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Cadmium
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• In Vitro Model: Anabaena sp. PCC7120; 1167
• In Vitro Model: Escherichia coli BL21 (DE3); 469008
• Experiment for Molecule Alteration: Immunoblotting analysis
• Experiment for Drug Resistance: Liquid culture assay
• Mechanism Description: PCC7120 a homolog of cadmium resistance-associated protein (CadD) involved in cadmium or heavy metal resistance or not, cloning and heterologous expression analysis of all3255 performed in Escherichia coli BL21 (DE3). Our results revealed that the strain transformed with pGEX-5X-2 + all3255 showed resistant towards not only to cadmium but also other heavy metals such as nickel, copper, zinc, lead and cobalt in addition to arsenic than those of transformed with empty vector (pGEX-5X-2).

References

• Ref 1: Decoding the role of hypothetical protein All3255 of Anabaena PCC7120 in heavy metal stress management in Escherichia coli. Arch Microbiol. 2018 Apr;200(3):463-471. doi: 10.1007/s00203-017-1462-2. Epub 2017 Nov 30.