Molecule Information
General Information of the Molecule (ID: Mol01122)
| Name |
TolC family outer membrane protein (TOLC)
,Acinetobacter baumannii
|
||||
|---|---|---|---|---|---|
| Synonyms |
tolC; CSB70_4010; NCTC13305_02171; Type I secretion outer membrane; TolC family protein
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
tolC
|
||||
| Sequence |
MKIKLMLVAGLWSFTSSSFALDLVETYERAKLNDPTWQANQQQFEADQLNLGLATGALLP
TVTLSGNITRNRQTVKRSNFPGVDQEGLSDALVSNTSTTKQATLSARQPLFRMDAWEGYK QVKTSVALSEITLRLQKQDHVLNVAEAYFNVLRQQALTAAYLQEEKALLEQLNMMNAKLK EGLVARSDVSEANAQYQNARANRIATNVQLLLAQEQLSEYIGPYQDKLAVLRSDFIFQKP YPAQLDEWLGLAQQQNLKIQQARLQKRYAEDQRRVEKAALYPQIDAVASYGYTKQTPETL ISTDGKFDQVGVEMNWNLFNGGRTRTSIKKASVELNKAQAQLDAAIRRANVDVKSAFMQV DTDRAKLEARKAAMDSSALVSQASKASYNEGLKSMVDVLLAQRNAFSAKQDYLNAQYDYL LNVLRLKAAVGQLGEKDLVELNSWLTYQ Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
6 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Amikacin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AYE WT | 509173 | ||
| Acinetobacter baumannii AYE detaabuO | 509173 | |||
| Acinetobacter baumannii AYE detaabuO Omega abuO | 509173 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Disk diffusion test assay; E-strip test assay | |||
| Mechanism Description | AbuO, an OMP, confers broad-spectrum antimicrobial resistance via active efflux in A. baumannii. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Carbenicillin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AYE WT | 509173 | ||
| Acinetobacter baumannii AYE detaabuO | 509173 | |||
| Acinetobacter baumannii AYE detaabuO Omega abuO | 509173 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Disk diffusion test assay; E-strip test assay | |||
| Mechanism Description | AbuO, an OMP, confers broad-spectrum antimicrobial resistance via active efflux in A. baumannii. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Ceftriaxone | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AYE WT | 509173 | ||
| Acinetobacter baumannii AYE detaabuO | 509173 | |||
| Acinetobacter baumannii AYE detaabuO Omega abuO | 509173 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Disk diffusion test assay; E-strip test assay | |||
| Mechanism Description | AbuO, an OMP, confers broad-spectrum antimicrobial resistance via active efflux in A. baumannii. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Meropenem | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AYE WT | 509173 | ||
| Acinetobacter baumannii AYE detaabuO | 509173 | |||
| Acinetobacter baumannii AYE detaabuO Omega abuO | 509173 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Disk diffusion test assay; E-strip test assay | |||
| Mechanism Description | AbuO, an OMP, confers broad-spectrum antimicrobial resistance via active efflux in A. baumannii. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Streptomycin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AYE WT | 509173 | ||
| Acinetobacter baumannii AYE detaabuO | 509173 | |||
| Acinetobacter baumannii AYE detaabuO Omega abuO | 509173 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Disk diffusion test assay; E-strip test assay | |||
| Mechanism Description | AbuO, an OMP, confers broad-spectrum antimicrobial resistance via active efflux in A. baumannii. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Tigecycline | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Acinetobacter baumannii AYE WT | 509173 | ||
| Acinetobacter baumannii AYE detaabuO | 509173 | |||
| Acinetobacter baumannii AYE detaabuO Omega abuO | 509173 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Disk diffusion test assay; E-strip test assay | |||
| Mechanism Description | AbuO, an OMP, confers broad-spectrum antimicrobial resistance via active efflux in A. baumannii. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
