Molecule Information
General Information of the Molecule (ID: Mol01117)
Name |
Tetracycline resistance protein TetW (TETW)
,Butyrivibrio fibrisolvens
|
||||
---|---|---|---|---|---|
Synonyms |
Tet(W); tet(W)
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
tetW
|
||||
Gene ID | |||||
Sequence |
MKIINIGILAHVDAGKTTLTESLLYASGAISEPGSVEKGTTRTDTMFLERQRGITIQAAV
TSFQWHRCKVNIVDTPGHMDFLAEVYRSLAVLDGAILVISAKDGVQAQTRILFHALRKMN IPTVIFINKIDQAGVDLQSVVQSVRDKLSADIIIKQTVSLSPEIVLEENTDIEAWDAVIE NNDELLEKYIAGEPISREKLAREEQQRVQDASLFPVYHGSAKNGLGIQPLMDAVTGLFQP IGEQGGAALCGSVFKVEYTDCGQRRVYLRLYSGTLRLRDTVALAGREKLKITEMRIPSKG EIVRTDTAYQGEIVILPSDSVRLNDVLGDQTRLPRKRWREDPLPMLRTTIAPKTAAQRER LLDALTQLADTDPLLRCEVDSITHEIILSFLGRVQLEVVSALLSEKYKLETVVKEPSVIY MERPLKAASHTIHIEVPPNPFWASIGLSVTPLSLGSGVQYESRVSLGYLNQSFQNAVRDG IRYGLEQGLFGWNVTDCKICFEYGLYYSPVSTPADFRSLAPIVLEQALKESGTQLLEPYL SFILYAPQEYLSRAYHDAPKYCATIETAQVKKDEVVFTGEIPARCIQAYRTDLAFYTNGR SVCLTELKGYQAAVGQPVIQPRRPNSRLDKVRHMFQKVM Click to Show/Hide
|
||||
Function |
Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Butyrivibrio fibrisolvens infection | [1] | |||
Resistant Disease | Butyrivibrio fibrisolvens infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Tetracycline | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Bifidobacterium longum strain F10 | 216816 | ||
Bifidobacterium longum strain F5 | 216816 | |||
Bifidobacterium longum strain F8 | 216816 | |||
Butyrivibrio fibrisolvens strain 1.23 | 831 | |||
Butyrivibrio fibrisolvens strain 1.230 | 831 | |||
Butyrivibrio fibrisolvens strain Jk214 | 831 | |||
Butyrivibrio fibrisolvens strain Jk51 | 831 | |||
Fusobacterium prausnitzii strain k10 | 853 | |||
Mitsuokella multiacidus strain 46/5(2) | 52226 | |||
Mitsuokella multiacidus strain P208-58 | 52226 | |||
Selenomonas ruminantium strain FB32 | 971 | |||
Selenomonas ruminantium strain FB322 | 971 | |||
Selenomonas ruminantium strain FB34 | 971 | |||
Experiment for Molecule Alteration |
Southern blotting assay | |||
Mechanism Description | Members of our group recently identified a new tetracycline resistance gene, tet(W), in three genera of rumen obligate anaerobes. Here, we show that tet(W) is also present in bacteria isolated from human feces. The tet(W) genes found in human Fusobacterium prausnitzii and Bifidobacterium longum isolates were more than 99.9% identical to those from a rumen isolate of Butyrivibrio fibrisolvens. | |||
Disease Class: Bartonella bacilliformis infection | [1] | |||
Resistant Disease | Bartonella bacilliformis infection [ICD-11: 1C11.0] | |||
Resistant Drug | Tetracycline | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Bifidobacterium longum strain F10 | 216816 | ||
Bifidobacterium longum strain F5 | 216816 | |||
Bifidobacterium longum strain F8 | 216816 | |||
Butyrivibrio fibrisolvens strain 1.23 | 831 | |||
Butyrivibrio fibrisolvens strain 1.230 | 831 | |||
Butyrivibrio fibrisolvens strain Jk214 | 831 | |||
Butyrivibrio fibrisolvens strain Jk51 | 831 | |||
Fusobacterium prausnitzii strain k10 | 853 | |||
Mitsuokella multiacidus strain 46/5(2) | 52226 | |||
Mitsuokella multiacidus strain P208-58 | 52226 | |||
Selenomonas ruminantium strain FB32 | 971 | |||
Selenomonas ruminantium strain FB322 | 971 | |||
Selenomonas ruminantium strain FB34 | 971 | |||
Experiment for Molecule Alteration |
Southern blotting assay | |||
Mechanism Description | Members of our group recently identified a new tetracycline resistance gene, tet(W), in three genera of rumen obligate anaerobes. Here, we show that tet(W) is also present in bacteria isolated from human feces. The tet(W) genes found in human Fusobacterium prausnitzii and Bifidobacterium longum isolates were more than 99.9% identical to those from a rumen isolate of Butyrivibrio fibrisolvens. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.