General Information of the Molecule (ID: Mol01117)
Name
Tetracycline resistance protein TetW (TETW) ,Butyrivibrio fibrisolvens
Synonyms
Tet(W); tet(W)
    Click to Show/Hide
Molecule Type
Protein
Gene Name
tetW
Gene ID
64114426
Sequence
MKIINIGILAHVDAGKTTLTESLLYASGAISEPGSVEKGTTRTDTMFLERQRGITIQAAV
TSFQWHRCKVNIVDTPGHMDFLAEVYRSLAVLDGAILVISAKDGVQAQTRILFHALRKMN
IPTVIFINKIDQAGVDLQSVVQSVRDKLSADIIIKQTVSLSPEIVLEENTDIEAWDAVIE
NNDELLEKYIAGEPISREKLAREEQQRVQDASLFPVYHGSAKNGLGIQPLMDAVTGLFQP
IGEQGGAALCGSVFKVEYTDCGQRRVYLRLYSGTLRLRDTVALAGREKLKITEMRIPSKG
EIVRTDTAYQGEIVILPSDSVRLNDVLGDQTRLPRKRWREDPLPMLRTTIAPKTAAQRER
LLDALTQLADTDPLLRCEVDSITHEIILSFLGRVQLEVVSALLSEKYKLETVVKEPSVIY
MERPLKAASHTIHIEVPPNPFWASIGLSVTPLSLGSGVQYESRVSLGYLNQSFQNAVRDG
IRYGLEQGLFGWNVTDCKICFEYGLYYSPVSTPADFRSLAPIVLEQALKESGTQLLEPYL
SFILYAPQEYLSRAYHDAPKYCATIETAQVKKDEVVFTGEIPARCIQAYRTDLAFYTNGR
SVCLTELKGYQAAVGQPVIQPRRPNSRLDKVRHMFQKVM
    Click to Show/Hide
Function
Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.
    Click to Show/Hide
Uniprot ID
TETW_BUTFI
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Firmicutes
Class: Clostridia
Order: Eubacteriales
Family: Lachnospiraceae
Genus: Butyrivibrio
Species: Butyrivibrio fibrisolvens
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Tetracycline
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Butyrivibrio fibrisolvens infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Butyrivibrio fibrisolvens infection [ICD-11: 1A00-1C4Z]
Resistant Drug Tetracycline
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Bifidobacterium longum strain F10 216816
Bifidobacterium longum strain F5 216816
Bifidobacterium longum strain F8 216816
Butyrivibrio fibrisolvens strain 1.23 831
Butyrivibrio fibrisolvens strain 1.230 831
Butyrivibrio fibrisolvens strain Jk214 831
Butyrivibrio fibrisolvens strain Jk51 831
Fusobacterium prausnitzii strain k10 853
Mitsuokella multiacidus strain 46/5(2) 52226
Mitsuokella multiacidus strain P208-58 52226
Selenomonas ruminantium strain FB32 971
Selenomonas ruminantium strain FB322 971
Selenomonas ruminantium strain FB34 971
Experiment for
Molecule Alteration
Southern blotting assay
Mechanism Description Members of our group recently identified a new tetracycline resistance gene, tet(W), in three genera of rumen obligate anaerobes. Here, we show that tet(W) is also present in bacteria isolated from human feces. The tet(W) genes found in human Fusobacterium prausnitzii and Bifidobacterium longum isolates were more than 99.9% identical to those from a rumen isolate of Butyrivibrio fibrisolvens.
Disease Class: Bartonella bacilliformis infection [ICD-11: 1C11.0] [1]
Resistant Disease Bartonella bacilliformis infection [ICD-11: 1C11.0]
Resistant Drug Tetracycline
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Bifidobacterium longum strain F10 216816
Bifidobacterium longum strain F5 216816
Bifidobacterium longum strain F8 216816
Butyrivibrio fibrisolvens strain 1.23 831
Butyrivibrio fibrisolvens strain 1.230 831
Butyrivibrio fibrisolvens strain Jk214 831
Butyrivibrio fibrisolvens strain Jk51 831
Fusobacterium prausnitzii strain k10 853
Mitsuokella multiacidus strain 46/5(2) 52226
Mitsuokella multiacidus strain P208-58 52226
Selenomonas ruminantium strain FB32 971
Selenomonas ruminantium strain FB322 971
Selenomonas ruminantium strain FB34 971
Experiment for
Molecule Alteration
Southern blotting assay
Mechanism Description Members of our group recently identified a new tetracycline resistance gene, tet(W), in three genera of rumen obligate anaerobes. Here, we show that tet(W) is also present in bacteria isolated from human feces. The tet(W) genes found in human Fusobacterium prausnitzii and Bifidobacterium longum isolates were more than 99.9% identical to those from a rumen isolate of Butyrivibrio fibrisolvens.
References
Ref 1 Occurrence of the new tetracycline resistance gene tet(W) in bacteria from the human gut. Antimicrob Agents Chemother. 2000 Mar;44(3):775-7. doi: 10.1128/AAC.44.3.775-777.2000.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.