General Information of the Molecule (ID: Mol01113)
Name
Tetracycline resistance protein TetQ (TETQ) ,Bacteroides sp.(Bacteroides coprosuis)
Molecule Type
Protein
Gene Name
tet(36)
Sequence
MRTINIGILAHIDAGKTSITENLLFASGATIVRGSVDKGNTTTDSMDIEKRRGITVRAST
TSIQWNDTKINIIDTPGHMDFLAEVERTFRMLDGAILVVSAKEGIQAQTRLLFNVLQQLE
IPTILFVNKIDREGVNLNQLYLEIQNSLSKDIIFMQSVEGKELTSSCTIHYISEKNRETI
LEKDDLLLEKYLSDTQLSNLDYWNSMVRLVQAAKLHPIYHGSAMYGIGIEDLLNSITTFI
ETSLPQENALSAYVYKIEHNKKEQKRAYLKIIGGTLKSRKLYSLNGSDENLKIRGLKTFY
SGDEIDVDEVFTNDIAIADHADNLMVGDYLGIMPNLFDKLNIPSPALKSSIHPAKVENRS
KLISAMNVLSVEDPSLAFSINADNNELEVSLYGATQREVILTLLEERFSVDAYFEEVKTI
YKERLKTKSEYTIHIEVPPNPYWASIGLIIEPLPIGAGLVMESEISLGYLNRSFQNAVFD
GVKKACESGLYGWEVTDLKVTFSHGIYYSPVSTPADFRSLAPYVFRLALQQADVELLEPI
LDFKLQIPLAVNARAITDINKMQGEISTITSDGDWTTILGNIPLDTSKEYSAEVSSYTQG
LGVFVTRFSGYRPTNKKVSRSVELNEKDKLMYMFEKESIK
    Click to Show/Hide
Function
Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.
    Click to Show/Hide
Uniprot ID
Q7WT01_9BACE
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Bacteroidetes
Class: Bacteroidia
Order: Bacteroidales
Family: Bacteroidaceae
Genus: Bacteroides
Species: Bacteroides coprosuis
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
6 drug(s) in total
Click to Show/Hide the Full List of Drugs
Chlortetracycline
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Bacteroides spp infection [1]
Resistant Disease Bacteroides spp infection [ICD-11: 1C4Y.9]
Resistant Drug Chlortetracycline
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli DH5alpha 668369
Experiment for
Molecule Alteration
PCR; Dot blot and Southern blot analysis
Experiment for
Drug Resistance
MIC assay
Mechanism Description Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance.
Demeclocycline
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Bacteroides spp infection [1]
Resistant Disease Bacteroides spp infection [ICD-11: 1C4Y.9]
Resistant Drug Demeclocycline
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli DH5alpha 668369
Experiment for
Molecule Alteration
PCR; Dot blot and Southern blot analysis
Experiment for
Drug Resistance
MIC assay
Mechanism Description Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance.
Doxycycline
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Bacteroides spp infection [1]
Resistant Disease Bacteroides spp infection [ICD-11: 1C4Y.9]
Resistant Drug Doxycycline
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli DH5alpha 668369
Experiment for
Molecule Alteration
PCR; Dot blot and Southern blot analysis
Experiment for
Drug Resistance
MIC assay
Mechanism Description Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance.
Minocycline
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Bacteroides spp infection [1]
Resistant Disease Bacteroides spp infection [ICD-11: 1C4Y.9]
Resistant Drug Minocycline
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli DH5alpha 668369
Experiment for
Molecule Alteration
PCR; Dot blot and Southern blot analysis
Experiment for
Drug Resistance
MIC assay
Mechanism Description Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance.
Oxytetracycline
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Bacteroides spp infection [1]
Resistant Disease Bacteroides spp infection [ICD-11: 1C4Y.9]
Resistant Drug Oxytetracycline
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli DH5alpha 668369
Experiment for
Molecule Alteration
PCR; Dot blot and Southern blot analysis
Experiment for
Drug Resistance
MIC assay
Mechanism Description Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance.
Tetracycline
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Bacteroides spp infection [1]
Resistant Disease Bacteroides spp infection [ICD-11: 1C4Y.9]
Resistant Drug Tetracycline
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli DH5alpha 668369
Experiment for
Molecule Alteration
PCR; Dot blot and Southern blot analysis
Experiment for
Drug Resistance
MIC assay
Mechanism Description Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance.
References
Ref 1 Identification of a new ribosomal protection type of tetracycline resistance gene, tet(36), from swine manure pits. Appl Environ Microbiol. 2003 Jul;69(7):4151-8. doi: 10.1128/AEM.69.7.4151-4158.2003.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.