Molecule Information
General Information of the Molecule (ID: Mol01113)
Name |
Tetracycline resistance protein TetQ (TETQ)
,Bacteroides sp.(Bacteroides coprosuis)
|
||||
---|---|---|---|---|---|
Molecule Type |
Protein
|
||||
Gene Name |
tet(36)
|
||||
Sequence |
MRTINIGILAHIDAGKTSITENLLFASGATIVRGSVDKGNTTTDSMDIEKRRGITVRAST
TSIQWNDTKINIIDTPGHMDFLAEVERTFRMLDGAILVVSAKEGIQAQTRLLFNVLQQLE IPTILFVNKIDREGVNLNQLYLEIQNSLSKDIIFMQSVEGKELTSSCTIHYISEKNRETI LEKDDLLLEKYLSDTQLSNLDYWNSMVRLVQAAKLHPIYHGSAMYGIGIEDLLNSITTFI ETSLPQENALSAYVYKIEHNKKEQKRAYLKIIGGTLKSRKLYSLNGSDENLKIRGLKTFY SGDEIDVDEVFTNDIAIADHADNLMVGDYLGIMPNLFDKLNIPSPALKSSIHPAKVENRS KLISAMNVLSVEDPSLAFSINADNNELEVSLYGATQREVILTLLEERFSVDAYFEEVKTI YKERLKTKSEYTIHIEVPPNPYWASIGLIIEPLPIGAGLVMESEISLGYLNRSFQNAVFD GVKKACESGLYGWEVTDLKVTFSHGIYYSPVSTPADFRSLAPYVFRLALQQADVELLEPI LDFKLQIPLAVNARAITDINKMQGEISTITSDGDWTTILGNIPLDTSKEYSAEVSSYTQG LGVFVTRFSGYRPTNKKVSRSVELNEKDKLMYMFEKESIK Click to Show/Hide
|
||||
Function |
Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
6 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacteroides spp infection | [1] | |||
Resistant Disease | Bacteroides spp infection [ICD-11: 1C4Y.9] | |||
Resistant Drug | Chlortetracycline | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Experiment for Molecule Alteration |
PCR; Dot blot and Southern blot analysis | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacteroides spp infection | [1] | |||
Resistant Disease | Bacteroides spp infection [ICD-11: 1C4Y.9] | |||
Resistant Drug | Demeclocycline | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Experiment for Molecule Alteration |
PCR; Dot blot and Southern blot analysis | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacteroides spp infection | [1] | |||
Resistant Disease | Bacteroides spp infection [ICD-11: 1C4Y.9] | |||
Resistant Drug | Doxycycline | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Experiment for Molecule Alteration |
PCR; Dot blot and Southern blot analysis | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacteroides spp infection | [1] | |||
Resistant Disease | Bacteroides spp infection [ICD-11: 1C4Y.9] | |||
Resistant Drug | Minocycline | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Experiment for Molecule Alteration |
PCR; Dot blot and Southern blot analysis | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacteroides spp infection | [1] | |||
Resistant Disease | Bacteroides spp infection [ICD-11: 1C4Y.9] | |||
Resistant Drug | Oxytetracycline | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Experiment for Molecule Alteration |
PCR; Dot blot and Southern blot analysis | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacteroides spp infection | [1] | |||
Resistant Disease | Bacteroides spp infection [ICD-11: 1C4Y.9] | |||
Resistant Drug | Tetracycline | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Experiment for Molecule Alteration |
PCR; Dot blot and Southern blot analysis | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.