Molecule Information
General Information of the Molecule (ID: Mol01111)
Name |
Tetracycline resistance protein TetQ (TETQ)
,Bacteroides thetaiotaomicron
|
||||
---|---|---|---|---|---|
Synonyms |
TetA(Q)1; tet(Q)
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
tetQ
|
||||
Gene ID | |||||
Sequence |
MNIINLGILAHIDAGKTSVTENLLFASGATEKCGCVDNGDTITDSMDIEKRRGITVRAST
TSIIWNGVKCNIIDTPGHMDFIAEVERTFKMLDGAVLILSAKEGIQAQTKLLFNTLQKLQ IPTIIFINKIDRAGVNLERLYLDIKANLSQDVLFMQNVVDGSVYPVCSQTYIKEEYKEFV CNHDDNILERYLADSEISPADYWNTIIALVAKAKVYPVLHGSAMFNIGINELLDAITSFI LPPASVSNRLSSYLYKIEHDPKGHKRSFLKIIDGSLRLRDVVRINDSEKFIKIKNLKTIN QGREINVDEVGANDIAIVEDMDDFRIGNYLGAEPCLIQGLSHQHPALKSSVRPDRPEERS KVISALNTLWIEDPSLSFSINSYSDELEISLYGLTQKEIIQTLLEERFSVKVHFDEIKTI YKERPVKKVNKIIQIEVPPNPYWATIGLTLEPLPLGTGLQIESDISYGYLNHSFQNAVFE GIRMSCQSGLHGWEVTDLKVTFTQAEYYSPVSTPADFRQLTPYVFRLALQQSGVDILEPM LYFELQIPQAASSKAITDLQKMMSEIEDISCNNEWCHIKGKVPLNTSKDYASEVSSYTKG LGIFMVKPCGYQITKGGYSDNIRMNEKDKLLFMFQKSMSSK Click to Show/Hide
|
||||
Function |
Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacteroides distasonis infection | [1] | |||
Resistant Disease | Bacteroides distasonis infection [ICD-11: 1C4Y.5] | |||
Resistant Drug | Tetracycline | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Bacteroides distasonis strains | 823 | ||
Bacteroides distasonis strains V2002 | 823 | |||
Bacteroides distasonis strains V2003 | 823 | |||
Bacteroides distasonis strains V2004 | 823 | |||
Bacteroides fragilis strain | 817 | |||
Bacteroides fragilis strain V503 | 817 | |||
Bacteroides ovatus strains | 28116 | |||
Bacteroides ovatus strains V2008 | 28116 | |||
Bacteroides thetaiotaomicron strain | 818 | |||
Bacteroides thetaiotaomicron strain V2005 | 818 | |||
Bacteroides thetaiotaomicron strain V2006 | 818 | |||
Bacteroides thetaiotaomicron strain V2007 | 818 | |||
Bacteroides uniformis strain | 820 | |||
Bacteroides uniformis strain V1760 | 820 | |||
Bacteroides uniformis strain V1761 | 820 | |||
Bacteroides uniformis strain V1918 | 820 | |||
Bacteroides uniformis strain V1921 | 820 | |||
Bacteroides uniformis strain V2000 | 820 | |||
Bacteroides uniformis strain V2001 | 820 | |||
Bacteroides uniformis strain V528 | 820 | |||
Bacteroides uniformis strain V844 | 820 | |||
Experiment for Molecule Alteration |
Southern blotting assay | |||
Mechanism Description | Of 13 clinical isolates of the Bacteroides group, all were resistant to tetracycline (>10,ug/ml). The source of tetracycline resistance was investigated with the recently cloned tetQ gene, a ribosomal protection gene. | |||
Disease Class: Bacteroides thetaiotaomicron infection | [1] | |||
Resistant Disease | Bacteroides thetaiotaomicron infection [ICD-11: 1C4Y.10] | |||
Resistant Drug | Tetracycline | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Bacteroides distasonis strains | 823 | ||
Bacteroides distasonis strains V2002 | 823 | |||
Bacteroides distasonis strains V2003 | 823 | |||
Bacteroides distasonis strains V2004 | 823 | |||
Bacteroides fragilis strain | 817 | |||
Bacteroides fragilis strain V503 | 817 | |||
Bacteroides ovatus strains | 28116 | |||
Bacteroides ovatus strains V2008 | 28116 | |||
Bacteroides thetaiotaomicron strain | 818 | |||
Bacteroides thetaiotaomicron strain V2005 | 818 | |||
Bacteroides thetaiotaomicron strain V2006 | 818 | |||
Bacteroides thetaiotaomicron strain V2007 | 818 | |||
Bacteroides uniformis strain | 820 | |||
Bacteroides uniformis strain V1760 | 820 | |||
Bacteroides uniformis strain V1761 | 820 | |||
Bacteroides uniformis strain V1918 | 820 | |||
Bacteroides uniformis strain V1921 | 820 | |||
Bacteroides uniformis strain V2000 | 820 | |||
Bacteroides uniformis strain V2001 | 820 | |||
Bacteroides uniformis strain V528 | 820 | |||
Bacteroides uniformis strain V844 | 820 | |||
Experiment for Molecule Alteration |
Southern blotting assay | |||
Mechanism Description | Of 13 clinical isolates of the Bacteroides group, all were resistant to tetracycline (>10,ug/ml). The source of tetracycline resistance was investigated with the recently cloned tetQ gene, a ribosomal protection gene. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.