Molecule Information
General Information of the Molecule (ID: Mol01110)
| Name |
Tetracycline resistance protein TetM (TETM)
,Enterococcus faecalis
|
||||
|---|---|---|---|---|---|
| Synonyms |
TetM(1545); tet(M)
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
tetM
|
||||
| Sequence |
MKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDRGTTKTDNTLLERQRGITIQTAI
TSFQWKNTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLISAKDGVQAQTRILFHALRKIG IPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKVELHPNMRVMNFTESEQWDMVIE GNDYLLEKYTSGKLLEALELEQEESIRFHNCSLFPVYHGSAKNNIGIDNLIEVITNKFYS STHRGQSELCGKVFKIEYSEKRQRLAYIRLYSGVLHLRDPVRISEKEKIKITEMYTSING ELCKIDKAYSGEIVILQNEFLKLNSVLGDTKLLPQRERIENPLPLLQTTVEPSKPQQREM LLDALLEISDSDPLLRYYVDSATHEIILSFLGKVQMEVTCALLQEKYHVEIEIKEPTVIY MERPLKKAEYTIHIEVPPNPFWASIGLSVAPLPLGSGVQYESSVSLGYLNQSFQNAVMEG IRYGCEQGLYGWNVTDCKICFKYGLYYSPVSTPADFRMLAPIVLEQVLKKAGTELLEPYL SFKIYAPQEYLSRAYNDAPKYCANIVDTQLKNNEVILSGEIPARCIQEYRSDLTFFTNGR SVCLTELKGYHVTTGEPVCQPRRPNSRIDKVRYMFNKIT Click to Show/Hide
|
||||
| Function |
Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Enterococci infection | [1] | |||
| Resistant Disease | Enterococci infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Tetracycline | |||
| Molecule Alteration | Expression | Acquired |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Enterococcus faecalis OG1RF:pCF10 | 474186 | ||
| Enterococcus faecalis OG1SSp | 1351 | |||
| In Vivo Model | House fly model | House fly | ||
| Experiment for Molecule Alteration |
Bacterial colonies count assay | |||
| Experiment for Drug Resistance |
Broth dilution assay | |||
| Mechanism Description | Tetracycline resistance of Musca domestica occurred by transferring the plasmid transduced with tetracycline resistance gene TETM of Enterococcus into Musca domestica. | |||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
