Molecule Information
General Information of the Molecule (ID: Mol01109)
| Name |
Tetracycline resistance protein tet(59) (TET59)
,Escherichia coli
|
||||
|---|---|---|---|---|---|
| Synonyms |
tet(59); 59
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
tet(59)
|
||||
| Sequence |
MNKFAITALTITALDAMGIGLIMPVLPTLLREYVSAENLANHYGILLALYAIMQVFFAPL
LGKWSDKFGRRPILLLSLAGAAVDYTLLALSSSLWMLYVGRLISGVTGATGAVAASVIAD NTASQERTKWFGRLGAAFGIGLIAGPAIGGFTGQFSAHLPFIIAAILNALSFLVIMLIFK DNKIKNTEKNTTETAENSRPFLQVIKPVILLLFIFFMTQMIGQIPATTWVLFTEHRFQWG SMEVGLSLAGLGIMHALFQAFVAGAIAKKFNEKVTIIVGFVVDGAAFIILSLLTKGWMIY PTLILLAGGSIALPALQGLMSAQVNQTNQGKLQGVLVSLTNTTGVIGPLLFSFIFGQTLA SWDGWIWMIGAIMYVLLIVFILSFYRSTKKIVKIAKLPAS Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Chlortetracycline | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Escherichia coli EPI-300 | 562 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Tet(59) is preceded by a homolog of the tetracycline repressor tetR typically found upstream of tet genes encoding efflux pumps and include the two palindromic operator sequences present in all regulatory regions of the tet(A)-tet(R) family (33), suggesting that tet(59) probably belongs to the efflux pump family. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Oxytetracycline | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Escherichia coli EPI-300 | 562 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Tet(59) is preceded by a homolog of the tetracycline repressor tetR typically found upstream of tet genes encoding efflux pumps and include the two palindromic operator sequences present in all regulatory regions of the tet(A)-tet(R) family (33), suggesting that tet(59) probably belongs to the efflux pump family. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bacterial infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Tetracycline | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Escherichia coli EPI-300 | 562 | ||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | Tet(59) is preceded by a homolog of the tetracycline repressor tetR typically found upstream of tet genes encoding efflux pumps and include the two palindromic operator sequences present in all regulatory regions of the tet(A)-tet(R) family (33), suggesting that tet(59) probably belongs to the efflux pump family. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
